KEGG   Homo sapiens (human): 10246
Entry
10246             CDS       T01001                                 
Symbol
SLC17A2, NPT3
Name
(RefSeq) solute carrier family 17 member 2
  KO
K12300  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 1/2/3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10246 (SLC17A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   10246 (SLC17A2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    10246 (SLC17A2)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 10246
NCBI-ProteinID: NP_005826
OMIM: 611049
HGNC: 10930
Ensembl: ENSG00000112337
Pharos: O00624(Tbio)
UniProt: O00624 A0A024QZY2
Position
6:complement(25912754..25930691)
AA seq 436 aa
MDGKPATRKGPDFCSLRYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQGLSNASTE
GPVADAFNNSSISIKEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKK
MLGAGLLISSLLTLFTPLAADFGVILVIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSK
LTTIAGSGSAFGSFIILCVGGLISQALSWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPC
ISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIFLGFFSHFWLCTIILTYLPTYI
STLLHVNIRDSGVLSSLPFIAAASCTILGGQLADFLLSRNLLRLITVRKLFSSLDMQVSS
WESQGDLGSSQESSLPLPLDSSSVRILSLVGGMSFSCLLQSTCLAWSFTSRLDKQNFKTG
PKRGPLPASEDIKLQT
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggacgggaagcctgccaccaggaaaggtccagatttctgttcattacgctatgggctg
gctcttatcatgcacttctcaaacttcaccatgataacgcagcgtgtgagtctgagcatt
gcgatcatcgccatggtgaacaccactcagcagcaaggtctatctaatgcctccactgag
gggcctgttgcagatgccttcaataactccagcatatccatcaaggaatttgatacaaag
gcctctgtgtatcaatggagcccagaaactcagggtatcatctttagctccatcaactat
gggataatactgactctgatcccaagtggatatttagcagggatatttggagcaaaaaaa
atgcttggtgctggtttgctgatctcttcccttctcaccctctttacaccactggctgct
gacttcggagtgattttggtcatcatggttcggacagtccagggcatggcccagggaatg
gcatggacaggtcagtttactatttgggcaaagtgggctcctccacttgaacgaagcaag
ctcaccaccattgcaggatcagggtcagcatttggatccttcatcatcctctgtgtgggg
ggactaatctcacaggccttgagctggccttttatcttctacatctttggtagcactggc
tgtgtctgctgtctcctatggttcacagtgatttatgatgaccccatgcatcacccgtgc
ataagtgttagggaaaaggagcacatcctgtcctcactggctcaacagcccagttctcct
ggacgagctgtccccataaaggcgatggtcacatgcctaccactttgggccattttcctg
ggttttttcagccatttctggttgtgcaccatcatcctaacatacctaccaacgtatatc
agtactctgctccatgttaacatcagagatagtggagttctgtcctccctgccttttatt
gctgctgcaagctgtacaattttaggaggtcagctggcagatttccttttgtccaggaat
cttctcagattgatcactgtgcgaaagctcttttcatctcttgatatgcaagtttcctca
tgggaatctcaaggggatttgggctcatcgcaggaatcatctcttccactgccactggat
tcctcatcagtcaggattttgagtctggttggaggaatgtctttttcctgtctgctgcag
tcaacatgtttggcctggtcttttacctcacgtttggacaagcagaacttcaagactggg
ccaaagagaggacccttacccgcctctgaggacataaagttacaaacttaa

DBGET integrated database retrieval system