KEGG   Homo sapiens (human): 10247
Entry
10247             CDS       T01001                                 

Gene name
RIDA, HRSP12, P14.5, PSP, UK114, hp14.5
Definition
(RefSeq) reactive intermediate imine deaminase A homolog
  KO
K09022  2-iminobutanoate/2-iminopropanoate deaminase [EC:3.5.99.10]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    10247 (RIDA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.10  2-iminobutanoate/2-iminopropanoate deaminase
     10247 (RIDA)
SSDB
Motif
Pfam: Ribonuc_L-PSP Corona_6B_7B
Other DBs
NCBI-GeneID: 10247
NCBI-ProteinID: NP_005827
OMIM: 602487
HGNC: 16897
Ensembl: ENSG00000132541
Vega: OTTHUMG00000164670
Pharos: P52758(Tbio)
UniProt: P52758 A0A024R9H2
Structure
PDB: 
1ONI

Position
8q22.2
AA seq 137 aa
MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALK
NMGEILKAAGCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSR
IEIEAVAIQGPLTTASL
NT seq 414 nt   +upstreamnt  +downstreamnt
atgtcgtccttgatcagaagggtgatcagcaccgcgaaagccccaggggccattggaccc
tacagtcaagctgtattagtcgacaggaccatttacatttcaggacagataggcatggac
ccttcaagtggacagcttgtgtcaggaggggtagcagaagaagctaaacaagctcttaaa
aacatgggtgaaattctgaaagctgcaggctgtgacttcactaacgtggtgaaaacaact
gttcttctggctgacataaatgacttcaatactgtcaatgaaatctacaaacagtatttc
aagagtaattttcctgctagagctgcttaccaagttgctgctttacccaaaggcagccga
attgaaattgaagcagtagctatccaaggaccactgacaacggcatcactataa

DBGET integrated database retrieval system