KEGG   Homo sapiens (human): 10249Help
Entry
10249             CDS       T01001                                 

Gene name
GLYAT, ACGNAT, CAT, GAT
Definition
(RefSeq) glycine-N-acyltransferase
  KO
K00628  glycine N-acyltransferase / glycine N-benzoyltransferase [EC:2.3.1.13 2.3.1.71]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00360  Phenylalanine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    10249 (GLYAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.13  glycine N-acyltransferase
     10249 (GLYAT)
    2.3.1.71  glycine N-benzoyltransferase
     10249 (GLYAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gly_acyl_tr_N Gly_acyl_tr_C FR47
Motif
Other DBs
NCBI-GeneID: 10249
NCBI-ProteinID: NP_964011
OMIM: 607424
HGNC: 13734
Ensembl: ENSG00000149124
Vega: OTTHUMG00000167429
Pharos: Q6IB77(Tbio)
UniProt: Q6IB77 A0A384P5E3
Position
11q12.1
AA seq 296 aa AA seqDB search
MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCP
QEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA
IKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPNGGKPKAINQEMFKLSSMDVTHAHL
VNKFWHFGGNERSQRFIERCIQTFPTCCLLGPEGTPVCWDLMDQTGEMRMAGTLPEYRLH
GLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVPL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaccattgcaaggtgcccagatgctgcagatgctggagaaatccttgaggaag
agcctcccagcatccttaaaggtttatggaactgtctttcacataaaccatggaaatcca
ttcaatctgaaggctgtggtggacaagtggcctgattttaatacagtggttgtctgccct
caggagcaggatatgacagatgaccttgatcactataccaatacttaccaaatctactcc
aaagatccccaaaactgtcaggaattccttggatcaccagaactcatcaactggaaacag
catttacagattcaaagttcacagcctagcctgaatgaggctatacaaaatcttgcagcc
attaagtccttcaaagtcaaacaaacacaacgcattctctatatggcagctgaaacagcc
aaggaactgactcctttcctgctgaaatcaaagattttatctcccaatggtggcaaaccc
aaggccatcaaccaagagatgtttaaactctcatccatggatgttacccatgctcacttg
gtgaataaattctggcattttggtggtaatgagaggagccagagattcattgagcgctgc
attcagacctttcccacctgctgtctcctggggcctgaggggacccctgtgtgctgggat
ctaatggaccagactggagagatgagaatggcaggcaccttgccggaataccggctccat
ggccttgtgacgtatgtcatctattcccacgcccagaaattgggcaaacttgggtttcct
gtctattctcatgtagactacagcaatgaagctatgcaaaaaatgagttacacactgcaa
catgttcccattcccagaagctggaaccagtggaactgtgtacctctgtga

DBGET integrated database retrieval system