KEGG   Homo sapiens (human): 1025Help
Entry
1025              CDS       T01001                                 

Gene name
CDK9, C-2k, CDC2L4, CTK1, PITALRE, TAK
Definition
(RefSeq) cyclin dependent kinase 9
  KO
K02211  cyclin-dependent kinase 9 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Drug target
Dinaciclib: D09604
Zotiraciclib: D11599
Zotiraciclib citrate: D11600
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1025 (CDK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1025 (CDK9)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    1025 (CDK9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1025 (CDK9)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     1025 (CDK9)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   1025 (CDK9)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     1025 (CDK9)
    Brd4/P-TEFb complex
     1025 (CDK9)
    7SK RNP complex
     1025 (CDK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 1025
NCBI-ProteinID: NP_001252
OMIM: 603251
HGNC: 1780
Ensembl: ENSG00000136807
Vega: OTTHUMG00000020715
Pharos: P50750(Tchem)
UniProt: P50750 A0A024R880
Structure
PDB: 

Position
9q34.11
AA seq 372 aa AA seqDB search
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcagtacgactcggtggagtgccctttttgtgatgaagtttccaaatacgag
aagctcgccaagatcggccaaggcaccttcggggaggtgttcaaggccaggcaccgcaag
accggccagaaggtggctctgaagaaggtgctgatggaaaacgagaaggaggggttcccc
attacagccttgcgggagatcaagatccttcagcttctaaaacacgagaatgtggtcaac
ttgattgagatttgtcgaaccaaagcttccccctataaccgctgcaagggtagtatatac
ctggtgttcgacttctgcgagcatgaccttgctgggctgttgagcaatgttttggtcaag
ttcacgctgtctgagatcaagagggtgatgcagatgctgcttaacggcctctactacatc
cacagaaacaagatcctgcatagggacatgaaggctgctaatgtgcttatcactcgtgat
ggggtcctgaagctggcagactttgggctggcccgggccttcagcctggccaagaacagc
cagcccaaccgctacaccaaccgtgtggtgacactctggtaccggcccccggagctgttg
ctcggggagcgggactacggcccccccattgacctgtggggtgctgggtgcatcatggca
gagatgtggacccgcagccccatcatgcagggcaacacggagcagcaccaactcgccctc
atcagtcagctctgcggctccatcacccctgaggtgtggccaaacgtggacaactatgag
ctgtacgaaaagctggagctggtcaagggccagaagcggaaggtgaaggacaggctgaag
gcctatgtgcgtgacccatacgcactggacctcatcgacaagctgctggtgctggaccct
gcccagcgcatcgacagcgatgacgccctcaaccacgacttcttctggtccgaccccatg
ccctccgacctcaagggcatgctctccacccacctgacgtccatgttcgagtacttggca
ccaccgcgccggaagggcagccagatcacccagcagtccaccaaccagagtcgcaatccc
gccaccaccaaccagacggagtttgagcgcgtcttctga

DBGET integrated database retrieval system