KEGG   Homo sapiens (human): 10263
Entry
10263             CDS       T01001                                 
Symbol
CDK2AP2, DOC-1R, p14
Name
(RefSeq) cyclin dependent kinase 2 associated protein 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CDK2AP
Other DBs
NCBI-GeneID: 10263
NCBI-ProteinID: NP_005842
HGNC: 30833
Ensembl: ENSG00000167797
Pharos: O75956(Tbio)
UniProt: O75956 Q6IAV4
Structure
Position
11:complement(67506497..67508162)
AA seq 126 aa
MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQ
AMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAET
ERNART
NT seq 381 nt   +upstreamnt  +downstreamnt
atgtcctacaaacccatcgcccctgctcccagcagcacccctggctccagcacccctggg
ccgggcaccccggtccctacaggaagcgtcccgtcgccgtcgggctcagtgccaggagcc
ggcgctcctttcagaccgctgtttaacgactttggaccgccttccatgggctacgtgcag
gcgatgaagccacccggcgcccagggctcccagagcacctacacggacctgctgtcagtc
atagaggagatgggcaaagagatccggcctacctatgctggcagcaagagcgccatggag
cgcctgaagagaggtatcatccatgcccgggccctagtcagagagtgcctggcagagaca
gagcggaacgcccgcacgtaa

DBGET integrated database retrieval system