KEGG   Homo sapiens (human): 10266
Entry
10266             CDS       T01001                                 

Gene name
RAMP2
Definition
(RefSeq) receptor activity modifying protein 2
  KO
K08448  receptor activity modifying protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10266 (RAMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10266 (RAMP2)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Others
   Receptor activity modifying protein
    10266 (RAMP2)
SSDB
Motif
Pfam: RAMP
Other DBs
NCBI-GeneID: 10266
NCBI-ProteinID: NP_005845
OMIM: 605154
HGNC: 9844
Ensembl: ENSG00000131477
Vega: OTTHUMG00000180648
Pharos: O60895(Tchem)
UniProt: O60895 A0A024R1Z2
Structure
PDB: 
3AQE 2XVT 3AQF

Position
17q21.2
AA seq 175 aa
MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKN
YETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERII
FETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcctcgctccgggtggagcgcgccggcggcccgcgtctccctaggacccgagtcggg
cggccggcagcgctccgcctcctcctcctgctgggcgctgtcctgaatccccacgaggcc
ctggctcagcctcttcccaccacaggcacaccagggtcagaaggggggacggtgaagaac
tatgagacagctgtccaattttgctggaatcattataaggatcaaatggatcctatcgaa
aaggattggtgcgactgggccatgattagcaggccttatagcaccctgcgagattgcctg
gagcactttgcagagttgtttgacctgggcttccccaatcccttggcagagaggatcatc
tttgagactcaccagatccactttgccaactgctccctggtgcagcccaccttctctgac
cccccagaggatgtactcctggccatgatcatagcccccatctgcctcatccccttcctc
atcactcttgtagtatggaggagtaaagacagtgaggcccaggcctag

DBGET integrated database retrieval system