KEGG   Homo sapiens (human): 102723407Help
Entry
102723407         CDS       T01001                                 

Gene name
IGH, IGH@, IGHV4, IGHV4-30, IGHV4-b, IGVH, IGVH4-39, IGVH4-b, IGVH4b, IgA, IgT, ighv
Definition
(RefSeq) immunoglobulin heavy variable 4-38-2-like
  KO
K06856  immunoglobulin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04672  Intestinal immune network for IgA production
hsa05130  Pathogenic Escherichia coli infection
hsa05140  Leishmaniasis
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05169  Epstein-Barr virus infection
hsa05202  Transcriptional misregulation in cancer
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05340  Primary immunodeficiency
hsa05414  Dilated cardiomyopathy (DCM)
hsa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102723407 (IGH)
   04020 Calcium signaling pathway
    102723407 (IGH)
   04072 Phospholipase D signaling pathway
    102723407 (IGH)
   04151 PI3K-Akt signaling pathway
    102723407 (IGH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102723407 (IGH)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102723407 (IGH)
   04650 Natural killer cell mediated cytotoxicity
    102723407 (IGH)
   04662 B cell receptor signaling pathway
    102723407 (IGH)
   04664 Fc epsilon RI signaling pathway
    102723407 (IGH)
   04666 Fc gamma R-mediated phagocytosis
    102723407 (IGH)
   04672 Intestinal immune network for IgA production
    102723407 (IGH)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102723407 (IGH)
  09163 Immune disease
   05310 Asthma
    102723407 (IGH)
   05322 Systemic lupus erythematosus
    102723407 (IGH)
   05323 Rheumatoid arthritis
    102723407 (IGH)
   05320 Autoimmune thyroid disease
    102723407 (IGH)
   05330 Allograft rejection
    102723407 (IGH)
   05340 Primary immunodeficiency
    102723407 (IGH)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102723407 (IGH)
   05416 Viral myocarditis
    102723407 (IGH)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    102723407 (IGH)
   05150 Staphylococcus aureus infection
    102723407 (IGH)
   05152 Tuberculosis
    102723407 (IGH)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102723407 (IGH)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102723407 (IGH)
   05140 Leishmaniasis
    102723407 (IGH)
   05143 African trypanosomiasis
    102723407 (IGH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    102723407 (IGH)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    102723407 (IGH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set
Motif
Other DBs
NCBI-GeneID: 102723407
NCBI-ProteinID: XP_011544500
Structure
PDB: 

Position
14
AA seq 217 aa AA seqDB search
MDLLCKNMKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGYSISSGYY
WGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVY
YCARDTVRGGECEPRHKPPCREAEGTGAGAAHGQQGARGAHGIQGRVRSRCRVSGACSSS
QRSSSPSSPAPQLSVEVLFLYCLWFYFLTSLCQERKE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggacctcctgtgcaagaacatgaagcacctgtggtttttcctcctgctggtggcagct
cccagatgggtcctgtcccaggtgcagctgcaggagtcgggcccaggactggtgaagcct
tcggagaccctgtccctcacctgcactgtctctggttactccatcagcagtggttactac
tggggctggatccggcagcccccagggaaggggctggagtggattgggagtatctatcat
agtgggagcacctactacaacccgtccctcaagagtcgagtcaccatatcagtagacacg
tccaagaaccagttctccctgaagctgagctctgtgaccgccgcagacacggccgtgtat
tactgtgcgagagacacagtgaggggaggtgagtgtgagcccagacacaaacctccctgc
agggaggctgaggggaccggcgcaggtgcagctcacggccagcagggggcgcgcggagct
cacggaatacaaggccgggtcaggagcaggtgcagggtgagcggggcttgctcatcttct
cagagatcatcatctccctcctcgccagcacctcagctttccgtagaggtcctctttctt
tattgtctgtggttctacttcctcacatccttgtgccaggaaagaaaggagtaa

DBGET integrated database retrieval system