KEGG   Homo sapiens (human): 102723532Help
Entry
102723532         CDS       T01001                                 

Definition
(RefSeq) olfactory receptor 4N4-like
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    102723532
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    102723532
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    102723532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 102723532
NCBI-ProteinID: XP_011544524
Ensembl: ENSG00000274792
UniProt: Q8N0Y3 A0A0G2JNH3
Position
15
AA seq 316 aa AA seqDB search
MKIANNTVVTEFILLGLTQSQDIQLLVFVLILIFYLIILPGNFLIIFTIRSDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFFSEKKVISYRGCITQLFFLHFLGGGEGLLLVVMAF
DRYIAICRPLHCSTVMNPRACYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDNFFCD
VRQVIKLACTDMFVVELLMVFNSGLMTLLCFLGLLASYAVILCHVRRAASEGKNKAMSMC
TTRVIIILLMFGPAIFIYMCPFRALPADKMVSLFHTVIFPLMNPMIYTLRNQEVKTSMKR
LLSRHVVCQVDFIIRN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagcaaacaacacagtagtgacagaatttatcctccttggtctgactcagtct
caagatattcagctcttggtctttgtgctgatcttaattttctaccttatcatcctccct
ggaaattttctcattattttcaccataaggtcagaccctgggctcacagcccccctctat
ttctttctgggcaacttggccttcctggatgcatcctactccttcattgtggctcccagg
atgttggtggacttcttctctgagaagaaggtaatctcctacagaggctgcatcactcag
ctctttttcttgcacttccttggaggaggggagggattactccttgttgtgatggccttt
gaccgctacatcgccatctgccggcctctgcactgttcaactgtcatgaaccctagagcc
tgctatgcaatgatgttggctctgtggcttgggggttttgtccactccattatccaggtg
gtcctcatcctccgcttgcctttttgtggcccaaaccagctggacaacttcttctgtgat
gtccgacaggtcatcaagctggcttgcaccgacatgtttgtggtggagcttctgatggtc
ttcaacagtggcctgatgacactcctgtgctttctggggcttctggcttcctatgcagtc
atcctctgccatgttcgtagggcagcttctgaagggaagaacaaggccatgtccatgtgc
accactcgtgtcattattatacttcttatgtttggacctgctatcttcatctacatgtgc
cctttcagggccttaccagctgacaagatggtttctctctttcacacagtgatctttcca
ttgatgaatcctatgatttatacccttcgcaaccaggaagtgaaaacttccatgaagagg
ttattgagtcgacatgtagtctgtcaagtggattttataataagaaactga

DBGET integrated database retrieval system