KEGG   Homo sapiens (human): 102723631Help
Entry
102723631         CDS       T01001                                 

Gene name
CT45A10, CT45-5, CT45A5
Definition
(RefSeq) cancer/testis antigen family 45 member A10
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: INT_SG_DDX_CT_C
Motif
Other DBs
NCBI-GeneID: 102723631
NCBI-ProteinID: NP_001278456
HGNC: 51263
Ensembl: ENSG00000269586
Vega: OTTHUMG00000022494
Pharos: P0DMU9(Tdark)
UniProt: P0DMU8 P0DMU9
Position
Xq26.3
AA seq 189 aa AA seqDB search
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMT
GHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSNFSGDDLECRGIASSPKSQQ
EINADIKCQVVKEIRCLGRKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKH
LKKKLKRMI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaaacagagaaggtggctgtagatcctgaaactgtgtttaaacgtcccagg
gaatgtgacagtccttcgtatcagaaaaggcagaggatggccctgttggcaaggaaacaa
ggagcaggagacagccttattgcaggctctgccatgtccaaagaaaagaagcttatgaca
ggacatgctattccacccagccaattggattctcagattgatgacttcactggtttcagc
aaagatgggatgatgcagaaacctggtagcaatgcacctgtgggaggaaacgttaccagc
aatttctctggagatgacctagaatgcagaggaatagcctcctctcccaaaagccaacaa
gaaattaatgctgatataaaatgtcaagtagtgaaggaaatccgatgccttggacgaaaa
tatgaaaaaatcttcgaaatgcttgaaggagtgcaaggacctactgcagtcaggaaacga
ttttttgaatccatcatcaaggaagcagcaagatgtatgagacgagactttgttaagcac
cttaagaagaaactgaaacgtatgatttga

DBGET integrated database retrieval system