KEGG   Homo sapiens (human): 102723996Help
Entry
102723996         CDS       T01001                                 

Definition
(RefSeq) ICOS ligand
  KO
K06710  inducible T-cell co-stimulator ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    102723996
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102723996
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    102723996
CD molecules [BR:hsa04090]
 Proteins
  102723996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 102723996
NCBI-ProteinID: NP_001350699
Ensembl: ENSG00000277117
Vega: OTTHUMG00000189355
Position
21p12
AA seq 302 aa AA seqDB search
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
HV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgggcagtcctggactgctcttcctgctcttcagcagccttcgagctgatact
caggagaaggaagtcagagcgatggtaggcagcgacgtggagctcagctgcgcttgccct
gaaggaagccgttttgatttaaatgatgtttacgtatattggcaaaccagtgagtcgaaa
accgtggtgacctaccacatcccacagaacagctccttggaaaacgtggacagccgctac
cggaaccgagccctgatgtcaccggccggcatgctgcggggcgacttctccctgcgcttg
ttcaacgtcaccccccaggacgagcagaagtttcactgcctggtgttgagccaatccctg
ggattccaggaggttttgagcgttgaggttacactgcatgtggcagcaaacttcagcgtg
cccgtcgtcagcgccccccacagcccctcccaggatgagctcaccttcacgtgtacatcc
ataaacggctaccccaggcccaacgtgtactggatcaataagacggacaacagcctgctg
gaccaggctctgcagaatgacaccgtcttcttgaacatgcggggcttgtatgacgtggtc
agcgtgctgaggatcgcacggacccccagcgtgaacattggctgctgcatagagaacgtg
cttctgcagcagaacctgactgtcggcagccagacaggaaatgacatcggagagagagac
aagatcacagagaatccagtcagtaccggcgagaaaaacgcggccacgtggagcatcctg
gctgtcctgtgcctgcttgtggtcgtggcggtggccataggctgggtgtgcagggaccga
tgcctccaacacagctatgcaggtgcctgggctgtgagtccggagacagagctcactggc
cacgtttga

KEGG   Homo sapiens (human): 23308Help
Entry
23308             CDS       T01001                                 

Gene name
ICOSLG, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, LICOS
Definition
(RefSeq) inducible T cell costimulator ligand
  KO
K06710  inducible T-cell co-stimulator ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    23308 (ICOSLG)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    23308 (ICOSLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    23308 (ICOSLG)
CD molecules [BR:hsa04090]
 Proteins
  23308 (ICOSLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 23308
NCBI-ProteinID: NP_056074
OMIM: 605717
HGNC: 17087
Ensembl: ENSG00000160223
Vega: OTTHUMG00000086920
Pharos: O75144(Tbio)
UniProt: O75144 A0N0L8
Position
21q22.3
AA seq 302 aa AA seqDB search
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
HV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgggcagtcctggactgctcttcctgctcttcagcagccttcgagctgatact
caggagaaggaagtcagagcgatggtaggcagcgacgtggagctcagctgcgcttgccct
gaaggaagccgttttgatttaaatgatgtttacgtatattggcaaaccagtgagtcgaaa
accgtggtgacctaccacatcccacagaacagctccttggaaaacgtggacagccgctac
cggaaccgagccctgatgtcaccggccggcatgctgcggggcgacttctccctgcgcttg
ttcaacgtcaccccccaggacgagcagaagtttcactgcctggtgttgagccaatccctg
ggattccaggaggttttgagcgttgaggttacactgcatgtggcagcaaacttcagcgtg
cccgtcgtcagcgccccccacagcccctcccaggatgagctcaccttcacgtgtacatcc
ataaacggctaccccaggcccaacgtgtactggatcaataagacggacaacagcctgctg
gaccaggctctgcagaatgacaccgtcttcttgaacatgcggggcttgtatgacgtggtc
agcgtgctgaggatcgcacggacccccagcgtgaacattggctgctgcatagagaacgtg
cttctgcagcagaacctgactgtcggcagccagacaggaaatgacatcggagagagagac
aagatcacagagaatccagtcagtaccggcgagaaaaacgcggccacgtggagcatcctg
gctgtcctgtgcctgcttgtggtcgtggcggtggccataggctgggtgtgcagggaccga
tgcctccaacacagctatgcaggtgcctgggctgtgagtccggagacagagctcactggc
cacgtttga

DBGET integrated database retrieval system