KEGG   Homo sapiens (human): 102724023Help
Entry
102724023         CDS       T01001                                 

Gene name
GATD3B, KNP-I
Definition
(RefSeq) glutamine amidotransferase like class 1 domain containing 3B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-GeneID: 102724023
NCBI-ProteinID: NP_001350687
HGNC: 53816
Ensembl: ENSG00000280071
Vega: OTTHUMG00000189357
Position
21p12
AA seq 268 aa AA seqDB search
MAAVRALVASRLAAASAFTSLSPGGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEI
HEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL
ANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAP
VLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTP
AFMCETALHYIHDGIGAMVRKVLELTGK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtgagggccctggtggcctcgaggctcgctgcggcatctgcattcacgtcc
ctgtcccccggcggtcggacgccttcccagcgcgcagcccttcacctctccgtgccgcgc
cccgcggccagggtcgcgctggtgctgtctggatgcggagtctacgatgggaccgagatc
cacgaggcctcggcgatcctggtgcacctgagccgtggaggggctgaagtccagatcttt
gctcctgacgtccctcagatgcacgtgattgaccacaccaaggggcagccgtccgaaggc
gagagcaggaatgttttgaccgagtctgcgaggatcgcccgtggcaaaatcacagacctg
gccaacctcagtgcagccaaccatgatgctgccatctttccaggaggctttggagcggct
aaaaacctgagcacgtttgccgtggacgggaaagattgcaaggtgaataaagaagtggag
cgtgtcctgaaggagttccaccaggccgggaagcccatcggcttgtgctgcattgcacct
gtcctcgcggccaaggtgctcagaggcgtcgaggtgactgtgggccacgagcaggaggaa
ggtggcaagtggccttatgccgggaccgcagaggccatcaaggccctgggtgccaagcac
tgcgtgaaggaagtggtcgaagctcacgtggaccagaaaaacaaggtggtcacgacccca
gccttcatgtgcgagacggcactccactacatccatgatgggatcggagccatggtgagg
aaggtgctggaactcactggaaagtga

DBGET integrated database retrieval system