KEGG   Homo sapiens (human): 102724334
Entry
102724334         CDS       T01001                                 

Definition
(RefSeq) histone H2B type F-S-like
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102724334
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102724334
  09165 Substance dependence
   05034 Alcoholism
    102724334
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    102724334
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    102724334
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    102724334
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102724334
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 102724334
NCBI-ProteinID: XP_006723981
Ensembl: ENSG00000274559
UniProt: P57053
Position
21p12
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccggagccagcgaagtccgctcccgcgcccaagaagggctcgaagaaagccgtgact
aaggcgcagaagaaggacggcaggaagcgcaagcgcagccgcaaggagagctactccgta
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcctctaaggccatg
ggaatcatgaactccttcgtcaacgacatcttcgaacgcatcgcaggtgaggcttcccgc
ctgccgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgctgcccggggagttggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagcgctaagtaa

DBGET integrated database retrieval system