KEGG   Homo sapiens (human): 102724594Help
Entry
102724594         CDS       T01001                                 

Gene name
U2AF1L5
Definition
(RefSeq) U2 small nuclear RNA auxiliary factor 1 like 5
  KO
K12836  splicing factor U2AF 35 kDa subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102724594 (U2AF1L5)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05131 Shigellosis
    102724594 (U2AF1L5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    102724594 (U2AF1L5)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    102724594 (U2AF1L5)
 Complex B
    102724594 (U2AF1L5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH RRM_1 zf_CCCH_4 Torus Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 102724594
NCBI-ProteinID: NP_001307575
HGNC: 51830
Ensembl: ENSG00000275895
Vega: OTTHUMG00000189373
UniProt: Q01081 P0DN76
Structure
PDB: 

Position
21p12
AA seq 240 aa AA seqDB search
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQ
SADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE
EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE
LRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtatctggcctccatcttcggcaccgagaaagacaaagtcaactgttcattt
tatttcaaaattggagcatgtcgtcatggagacaggtgctctcggttgcacaataaaccg
acgtttagccagaccattgccctcttgaacatttaccgtaaccctcaaaactcttcccag
tctgctgacggtttgcgctgtgccgtgagcgatgtggagatgcaggaacactatgatgag
ttttttgaggaggtttttacagaaatggaggagaagtatggggaagtagaggagatgaac
gtctgtgacaacctgggagaccacctggtggggaacgtgtacgtcaagtttcgccgtgag
gaagatgcggaaaaggctgtgattgacttgaataaccgttggtttaatggacagccgatc
cacgccgagctgtcacccgtgacggacttcagagaagcctgctgccgtcagtatgagatg
ggagaatgcacacgaggcggcttctgcaacttcatgcatttgaagcccatttccagagag
ctgcggcgggagctgtatggccgccgtcgcaagaagcatagatcaagatcccgatcccgg
gagcgtcgttctcggtctagagaccgtggtcgtggcggtggcggtggcggtggtggaggt
ggcggcggacgggagcgtgacaggaggcggtcgagagatcgtgaaagatctgggcgattc
tga

DBGET integrated database retrieval system