KEGG   Homo sapiens (human): 102724594
Entry
102724594         CDS       T01001                                 

Symbol
U2AF1L5
Name
(RefSeq) U2 small nuclear RNA auxiliary factor 1 like 5
  KO
K12836  splicing factor U2AF 35 kDa subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102724594 (U2AF1L5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    102724594 (U2AF1L5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    102724594 (U2AF1L5)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    102724594 (U2AF1L5)
 Complex B
    102724594 (U2AF1L5)
SSDB
Motif
Pfam: zf-CCCH RRM_1 Torus zf_CCCH_4 Nup35_RRM_2
Other DBs
NCBI-GeneID: 102724594
NCBI-ProteinID: NP_001307575
Ensembl: ENSG00000275895
Vega: OTTHUMG00000189373
UniProt: Q01081 P0DN76
Structure
PDB: 
1JMT

Position
21p12
AA seq 240 aa
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQ
SADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE
EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE
LRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF
NT seq 723 nt   +upstreamnt  +downstreamnt
atggcggagtatctggcctccatcttcggcaccgagaaagacaaagtcaactgttcattt
tatttcaaaattggagcatgtcgtcatggagacaggtgctctcggttgcacaataaaccg
acgtttagccagaccattgccctcttgaacatttaccgtaaccctcaaaactcttcccag
tctgctgacggtttgcgctgtgccgtgagcgatgtggagatgcaggaacactatgatgag
ttttttgaggaggtttttacagaaatggaggagaagtatggggaagtagaggagatgaac
gtctgtgacaacctgggagaccacctggtggggaacgtgtacgtcaagtttcgccgtgag
gaagatgcggaaaaggctgtgattgacttgaataaccgttggtttaatggacagccgatc
cacgccgagctgtcacccgtgacggacttcagagaagcctgctgccgtcagtatgagatg
ggagaatgcacacgaggcggcttctgcaacttcatgcatttgaagcccatttccagagag
ctgcggcgggagctgtatggccgccgtcgcaagaagcatagatcaagatcccgatcccgg
gagcgtcgttctcggtctagagaccgtggtcgtggcggtggcggtggcggtggtggaggt
ggcggcggacgggagcgtgacaggaggcggtcgagagatcgtgaaagatctgggcgattc
tga

KEGG   Homo sapiens (human): 199746
Entry
199746            CDS       T01001                                 

Symbol
U2AF1L4, U2AF1-RS3, U2AF1L3, U2AF1L3V1, U2AF1RS3, U2af26
Name
(RefSeq) U2 small nuclear RNA auxiliary factor 1 like 4
  KO
K12836  splicing factor U2AF 35 kDa subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    199746 (U2AF1L4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    199746 (U2AF1L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    199746 (U2AF1L4)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    199746 (U2AF1L4)
 Complex B
    199746 (U2AF1L4)
SSDB
Motif
Pfam: zf-CCCH RRM_1 Torus zf_CCCH_4 His_Phos_2
Other DBs
NCBI-GeneID: 199746
NCBI-ProteinID: NP_659424
OMIM: 601080
HGNC: 23020
Ensembl: ENSG00000161265
Vega: OTTHUMG00000182066
Pharos: Q8WU68(Tdark)
UniProt: Q8WU68
Position
19q13.12
AA seq 202 aa
MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEM
NVCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFP
RTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQ
DLSSKPPSLSCPILPRLPGSIM
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctgaatatttagcttcgatattcgggactgagaaggacaaggttaactgctctttt
tactttaagatcggggtctgccggcacggggaccggtgctcccggcttcacaacaagccg
acattcagccaggaggtgttcacagaactgcaggagaagtatggggagattgaagagatg
aatgtgtgcgacaaccttggggaccacctcgtgggcaacgtctatgtcaagttccggagg
gaggaggatggagagcgggccgtggctgaactcagtaaccgctggttcaacgggcaggct
gtgcacgggaatgtacccgaggtggcttctgcaacttcatgcatctgcggcccatttccc
agaacctccagaggcagctctatgggcggggacccaggcgcaggtcacccccgaggttcc
atactggccaccatccccgagagaggaaccatcggtgttcccctgatcactggcatggcc
gcttctgaggccctggcccccttacccttcacccccaacagggacagatgttcctggcag
gacctctcctcaaagcccccttcactctcctgccccatccttcccaggctcccgggctcc
ataatgtaa

KEGG   Homo sapiens (human): 7307
Entry
7307              CDS       T01001                                 

Symbol
U2AF1, FP793, RN, RNU2AF1, U2AF35, U2AFBP
Name
(RefSeq) U2 small nuclear RNA auxiliary factor 1
  KO
K12836  splicing factor U2AF 35 kDa subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05131  Shigellosis
Disease
H01481  Myelodysplastic syndrome
H02410  Myelodysplastic/myeloproliferative neoplasms
H02411  Chronic myelomonocytic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    7307 (U2AF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7307 (U2AF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    7307 (U2AF1)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    7307 (U2AF1)
 Complex B
    7307 (U2AF1)
SSDB
Motif
Pfam: zf-CCCH RRM_1 Torus zf_CCCH_4 KMP11 Nup35_RRM_2
Other DBs
NCBI-GeneID: 7307
NCBI-ProteinID: NP_001020374
OMIM: 191317
HGNC: 12453
Ensembl: ENSG00000160201
Vega: OTTHUMG00000086836
Pharos: Q01081(Tbio)
UniProt: Q01081
Position
21q22.3
AA seq 240 aa
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQ
TADGSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRRE
EDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRE
LRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF
NT seq 723 nt   +upstreamnt  +downstreamnt
atggcggagtatctggcctccatcttcggcaccgagaaagacaaagtcaactgttcattt
tatttcaaaattggagcatgtcgtcatggagacaggtgctctcggttgcacaataaaccg
acgtttagccagaccatcttgattcaaaacatctatcgtaatccccaaaacagtgcacag
acggctgacggctcacactgtgccgtgagcgatgtggagatgcaggaacactatgatgag
ttttttgaggaggtttttacagaaatggaggagaagtatggggaagtagaggagatgaac
gtctgtgacaacctgggagaccacctggtggggaacgtgtacgtcaagtttcgccgtgag
gaagatgcggaaaaggctgtgattgacttgaataaccgttggtttaatggacagccgatc
cacgccgagctgtcacccgtgacggacttcagagaagcctgctgccgtcagtatgagatg
ggagaatgcacacgaggcggcttctgcaacttcatgcatttgaagcccatttccagagag
ctgcggcgggagctgtatggccgccgtcgcaagaagcatagatcaagatcccgatcccgg
gagcgtcgttctcggtctagagaccgtggtcgtggcggtggcggtggcggtggtggaggt
ggcggcggacgggagcgtgacaggaggcggtcgagagatcgtgaaagatctgggcgattc
tga

DBGET integrated database retrieval system