KEGG   Homo sapiens (human): 102724652
Entry
102724652         CDS       T01001                                 

Gene name
CRYAA2, CRYAA
Definition
(RefSeq) crystallin alpha A2
  KO
K09541  crystallin, alpha A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102724652 (CRYAA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    102724652 (CRYAA2)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP20
   102724652 (CRYAA2)
SSDB
Motif
Pfam: Crystallin HSP20
Other DBs
NCBI-GeneID: 102724652
NCBI-ProteinID: NP_001300979
HGNC: 51901
Ensembl: ENSG00000276076
Vega: OTTHUMG00000189395
Pharos: P02489(Tbio)
UniProt: A0A140G945 P02489
Position
21p12
AA seq 173 aa
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSG
ISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRL
PSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
NT seq 522 nt   +upstreamnt  +downstreamnt
atggatgtgaccatccagcacccctggttcaagcgcaccctggggcccttctaccccagc
cggctgttcgaccagtttttcggcgagggcctttttgagtatgacctgctgcccttcctg
tcgtccaccatcagcccctactaccgccagtccctcttccgcaccgtgctggactccggc
atctctgaggttcgatccgaccgggacaagttcgtcatcttcctcgatgtgaagcacttc
tccccggaggacctcaccgtgaaggtgcaggacgactttgtggagatccacggaaagcac
aacgagcgccaggacgaccacggctacatttcccgtgagttccaccgccgctaccgcctg
ccgtccaacgtggaccagtcggccctctcttgctccctgtctgccgatggcatgctgacc
ttctgtggccccaagatccagactggcctggatgccacccacgccgagcgagccatcccc
gtgtcgcgggaggagaagcccacctcggctccctcgtcctaa

DBGET integrated database retrieval system