KEGG   Homo sapiens (human): 102724652
Entry
102724652         CDS       T01001                                 

Symbol
CRYAA, CRYAA2
Name
(RefSeq) crystallin alpha A2
  KO
K09541  crystallin, alpha A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102724652 (CRYAA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    102724652 (CRYAA)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP20
   102724652 (CRYAA)
SSDB
Motif
Pfam: Crystallin HSP20
Other DBs
NCBI-GeneID: 102724652
NCBI-ProteinID: NP_001300979
Ensembl: ENSG00000276076
Vega: OTTHUMG00000189395
Pharos: P02489(Tbio)
UniProt: A0A140G945 P02489
Position
21p12
AA seq 173 aa
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSG
ISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRL
PSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
NT seq 522 nt   +upstreamnt  +downstreamnt
atggatgtgaccatccagcacccctggttcaagcgcaccctggggcccttctaccccagc
cggctgttcgaccagtttttcggcgagggcctttttgagtatgacctgctgcccttcctg
tcgtccaccatcagcccctactaccgccagtccctcttccgcaccgtgctggactccggc
atctctgaggttcgatccgaccgggacaagttcgtcatcttcctcgatgtgaagcacttc
tccccggaggacctcaccgtgaaggtgcaggacgactttgtggagatccacggaaagcac
aacgagcgccaggacgaccacggctacatttcccgtgagttccaccgccgctaccgcctg
ccgtccaacgtggaccagtcggccctctcttgctccctgtctgccgatggcatgctgacc
ttctgtggccccaagatccagactggcctggatgccacccacgccgagcgagccatcccc
gtgtcgcgggaggagaagcccacctcggctccctcgtcctaa

KEGG   Homo sapiens (human): 1409
Entry
1409              CDS       T01001                                 

Symbol
CRYAA, CRYA1, CTRCT9, HSPB4
Name
(RefSeq) crystallin alpha A
  KO
K09541  crystallin, alpha A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1409 (CRYAA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    1409 (CRYAA)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP20
   1409 (CRYAA)
SSDB
Motif
Pfam: Crystallin HSP20
Other DBs
NCBI-GeneID: 1409
NCBI-ProteinID: NP_000385
OMIM: 123580
HGNC: 2388
Ensembl: ENSG00000160202
Vega: OTTHUMG00000086842
Pharos: P02489(Tbio)
UniProt: A0A140G945 P02489
Position
21q22.3
AA seq 173 aa
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSG
ISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRL
PSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
NT seq 522 nt   +upstreamnt  +downstreamnt
atggacgtgaccatccagcacccctggttcaagcgcaccctggggcccttctaccccagc
cggctgttcgaccagtttttcggcgagggcctttttgagtatgacctgctgcccttcctg
tcgtccaccatcagcccctactaccgccagtccctcttccgcaccgtgctggactccggc
atctctgaggttcgatccgaccgggacaagttcgtcatcttcctcgatgtgaagcacttc
tccccggaggacctcaccgtgaaggtgcaggacgactttgtggagatccacggaaagcac
aacgagcgccaggacgaccacggctacatttcccgtgagttccaccgccgctaccgcctg
ccgtccaacgtggaccagtcggccctctcttgctccctgtctgccgatggcatgctgacc
ttctgtggccccaagatccagactggcctggatgccacccacgccgagcgagccatcccc
gtgtcgcgggaggagaagcccacctcggctccctcgtcctaa

KEGG   Homo sapiens (human): 1410
Entry
1410              CDS       T01001                                 

Symbol
CRYAB, CMD1II, CRYA2, CTPP2, CTRCT16, HEL-S-101, HSPB5, MFM2
Name
(RefSeq) crystallin alpha B
  KO
K09542  crystallin, alpha B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04213  Longevity regulating pathway - multiple species
Disease
H00294  Dilated cardiomyopathy
H00595  Myofibrillar myopathies
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1410 (CRYAB)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    1410 (CRYAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    1410 (CRYAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1410 (CRYAB)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP20
   1410 (CRYAB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1410 (CRYAB)
SSDB
Motif
Pfam: Crystallin HSP20 ArsA_HSP20
Other DBs
NCBI-GeneID: 1410
NCBI-ProteinID: NP_001276736
OMIM: 123590
HGNC: 2389
Ensembl: ENSG00000109846
Vega: OTTHUMG00000166885
Pharos: P02511(Tbio)
UniProt: P02511 V9HW27
Structure
PDB: 

Position
11q23.1
AA seq 175 aa
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
NT seq 528 nt   +upstreamnt  +downstreamnt
atggacatcgccatccaccacccctggatccgccgccccttctttcctttccactccccc
agccgcctctttgaccagttcttcggagagcacctgttggagtctgatcttttcccgacg
tctacttccctgagtcccttctaccttcggccaccctccttcctgcgggcacccagctgg
tttgacactggactctcagagatgcgcctggagaaggacaggttctctgtcaacctggat
gtgaagcacttctccccagaggaactcaaagttaaggtgttgggagatgtgattgaggtg
catggaaaacatgaagagcgccaggatgaacatggtttcatctccagggagttccacagg
aaataccggatcccagctgatgtagaccctctcaccattacttcatccctgtcatctgat
ggggtcctcactgtgaatggaccaaggaaacaggtctctggccctgagcgcaccattccc
atcacccgtgaagagaagcctgctgtcaccgcagcccccaagaaatag

DBGET integrated database retrieval system