KEGG   Homo sapiens (human): 102725035
Entry
102725035         CDS       T01001                                 

Definition
(RefSeq) leukocyte immunoglobulin-like receptor subfamily B member 3
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    102725035
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102725035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    102725035
CD molecules [BR:hsa04090]
 Proteins
  102725035
SSDB
Motif
Pfam: Ig_2 Ig_3 ig RCSD
Other DBs
NCBI-GeneID: 102725035
NCBI-ProteinID: XP_006726377
UniProt: O75022
Position
19
AA seq 631 aa
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYRL
DKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLELVMTGF
YNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQAL
FPVGPVNPSHRWRFTCYYYYMNTPQVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQS
LTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAH
NLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEG
AAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSG
HSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKT
DFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQA
VTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHS
LTLRRKATEPPPSQEGEPPAEPSIYATLAIH
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgacgcccgccctcacagccctgctctgccttgggctgagtctgggccccaggacccgc
gtgcaggcagggcccttccccaaacccaccctctgggctgagccaggctctgtgatcagc
tgggggagccccgtgaccatctggtgtcaggggagcctggaggcccaggagtaccgactg
gataaagagggaagcccagagcccttggacagaaataacccactggaacccaagaacaag
gccagattctccatcccatccatgacagagcaccatgcggggagataccgctgccactat
tacagctctgcaggctggtcagagcccagcgaccccctggagctggtgatgacaggattc
tacaacaaacccaccctctcagccctgcccagccctgtggtggcctcaggggggaatatg
accctccgatgtggctcacagaagggatatcaccattttgttctgatgaaggaaggagaa
caccagctcccccggaccctggactcacagcagctccacagtggggggttccaggccctg
ttccctgtgggccccgtgaaccccagccacaggtggaggttcacatgctattactattat
atgaacaccccccaggtgtggtcccaccccagtgaccccctggagattctgccctcaggc
gtgtctaggaagccctccctcctgaccctgcagggccctgtcctggcccctgggcagagc
ctgaccctccagtgtggctctgatgtcggctacgacagatttgttctgtataaggagggg
gaacgtgacttcctccagcgccctggccagcagccccaggctgggctctcccaggccaac
ttcaccctgggccctgtgagcccctcccacgggggccagtacaggtgctatggtgcacac
aacctctcctccgagtggtcggcccccagcgaccccctgaacatcctgatggcaggacag
atctatgacaccgtctccctgtcagcacagccgggccccacagtggcctcaggagagaac
gtgaccctgctgtgtcagtcatggtggcagtttgacactttccttctgaccaaagaaggg
gcagcccatcccccactgcgtctgagatcaatgtacggagctcataagtaccaggctgaa
ttccccatgagtcctgtgacctcagcccacgcggggacctacaggtgctacggctcatac
agctccaacccccacctgctgtctttccccagtgagcccctggaactcatggtctcagga
cactctggaggctccagcctcccacccacagggccgccctccacacctggtctgggaaga
tacctggaggttttgattggggtctcggtggccttcgtcctgctgctcttcctcctcctc
ttcctcctcctccgacgtcagcgtcacagcaaacacaggacatctgaccagagaaagact
gatttccagcgtcctgcaggggctgcggagacagagcccaaggacaggggcctgctgagg
aggtccagcccagctgctgacgtccaggaagaaaacctctatgctgccgtgaaggacaca
cagtctgaggacagggtggagctggacagtcagagcccacacgatgaagacccccaggca
gtgacgtatgccccggtgaaacactccagtcctaggagagaaatggcctctcctccctcc
tcactgtctggggaattcctggacacaaaggacagacaggtggaagaggacaggcagatg
gacactgaggctgctgcatctgaagcctcccaggatgtgacctacgcccagctgcacagc
ttgacccttagacggaaggcaactgagcctcctccatcccaggaaggggaacctccagct
gagcccagcatctacgccactctggccatccactag

DBGET integrated database retrieval system