KEGG   Homo sapiens (human): 10273Help
Entry
10273             CDS       T01001                                 

Gene name
STUB1, CHIP, HSPABP2, NY-CO-7, SCA48, SCAR16, SDCCAG7, UBOX1
Definition
(RefSeq) STIP1 homology and U-box containing protein 1
  KO
K09561  STIP1 homology and U-box containing protein 1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10273 (STUB1)
   04120 Ubiquitin mediated proteolysis
    10273 (STUB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10273 (STUB1)
   04131 Membrane trafficking [BR:hsa04131]
    10273 (STUB1)
   04121 Ubiquitin system [BR:hsa04121]
    10273 (STUB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     10273 (STUB1)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Others
   10273 (STUB1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    10273 (STUB1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  U-box type E3
   10273 (STUB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: U-box CHIP_TPR_N TPR_1 TPR_2 ANAPC3 TPR_16 TPR_8 TPR_11 TPR_12 TPR_17 TPR_19 TPR_14 TPR_9 TPR_6 zf-NOSIP TPR_10
Motif
Other DBs
NCBI-GeneID: 10273
NCBI-ProteinID: NP_005852
OMIM: 607207
HGNC: 11427
Ensembl: ENSG00000103266
Vega: OTTHUMG00000121140
Pharos: Q9UNE7(Tbio)
UniProt: Q9UNE7
Structure
PDB: 

Position
16p13.3
AA seq 303 aa AA seqDB search
MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVA
VYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRA
YSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEEC
QRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELM
REPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWV
EDY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcaaggaggagaaggagggcggcgcacggctgggcgctggcggcggaagcccc
gagaagagcccgagcgcgcaggagctcaaggagcagggcaatcgtctgttcgtgggccga
aagtacccggaggcggcggcctgctacggccgcgcgatcacccggaacccgctggtggcc
gtgtattacaccaaccgggccttgtgctacctgaagatgcagcagcacgagcaggccctg
gccgactgccggcgcgccctggagctggacgggcagtctgtgaaggcgcacttcttcctg
gggcagtgccagctggagatggagagctatgatgaggccatcgccaatctgcagcgagct
tacagcctggccaaggagcagcggctgaacttcggggacgacatccccagcgctcttcga
atcgcgaagaagaagcgctggaacagcattgaggagcggcgcatccaccaggagagcgag
ctgcactcctacctctccaggctcattgccgcggagcgtgagagggagctggaagagtgc
cagcgaaaccacgagggtgatgaggacgacagccacgtccgggcccagcaggcctgcatt
gaggccaagcacgacaagtacatggcggacatggacgagcttttttctcaggtggatgag
aagaggaagaagcgagacatccccgactacctgtgtggcaagatcagctttgagctgatg
cgggagccgtgcatcacgcccagtggcatcacctacgaccgcaaggacatcgaggagcac
ctgcagcgtgtgggtcattttgaccccgtgacccggagccccctgacccaggaacagctc
atccccaacttggctatgaaggaggttattgacgcattcatctctgagaatggctgggtg
gaggactactga

DBGET integrated database retrieval system