KEGG   Homo sapiens (human): 10277
Entry
10277             CDS       T01001                                 

Symbol
UBE4B, E4, HDNB1, UBOX3, UFD2, UFD2A
Name
(RefSeq) ubiquitination factor E4B
  KO
K10597  ubiquitin conjugation factor E4 B [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10277 (UBE4B)
   04120 Ubiquitin mediated proteolysis
    10277 (UBE4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10277 (UBE4B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     10277 (UBE4B)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  U-box type E3
   10277 (UBE4B)
SSDB
Motif
Pfam: Ufd2P_core U-box
Other DBs
NCBI-GeneID: 10277
NCBI-ProteinID: NP_001099032
OMIM: 613565
HGNC: 12500
Ensembl: ENSG00000130939
Vega: OTTHUMG00000001797
Pharos: O95155(Tbio)
UniProt: O95155
Structure
PDB: 
5O75 3L1X 3L1Z 2KRE

Position
1p36.22
AA seq 1302 aa
MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNM
TPATSPIGASGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQV
DVDSGIENMEVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFL
SSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPD
RNLLLNTGSNPGTSPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAA
SQLAVPSTPLSPHSAASGTAAGSQPSSPRYRPYTVTHPWASSGVSILSSSPSPPALASSP
QAVPASSSRQRPSSTGPPLPPASPSATSRRPSSLRISPSLGASGGASNWDSYSDHFTIET
CKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPR
SLQQPSFLVPYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDSDY
FKYPLMALGELCETKFGKTHPVCNLVASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVF
AEDDVKVVEKYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLNGETREAALSY
MAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTKIKLETVDPTYIFHPRCRITL
PNDETRVNATMEDVNDWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSILPSCRRYIRRL
RAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFL
RRCLNFYGLLIQLLLRILDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYSP
QALYEPCTQDIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPAVQPRTQKFFEMIENHP
LSTKLLVPSLMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSG
KQFVRYINMLINDTTFLLDESLESLKRIHEVQEEMKNKEQWDQLPRDQQQARQSQLAQDE
RVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVEN
PEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKMRKAGIKSTIA
IEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILR
HLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH
NT seq 3909 nt   +upstreamnt  +downstreamnt
atggaggagctgagcgctgatgagattcgacggaggcgccttgcacgacttgctggtgga
cagacctctcagccaaccaccccactcacctctccccagagggagaaccctccggggcct
cccatagcggcatcagccccaggaccctctcagagtcttggtctcaatgtccacaacatg
accccagctacctccccaataggtgcatcaggagtagcccatcgaagccagagcagtgaa
ggagtcagttctctcagcagctcgccctctaatagccttgaaacgcaatctcagtctctc
tcacgttcccagagcatggatatcgatggtgtctcatgtgagaaaagcatgtcccaggtg
gatgtggattcaggaattgaaaacatggaggttgatgaaaatgatcgaagagaaaagcgg
agcctcagtgataaggagccttcctcgggccctgaagtgtctgaagagcaggccttacag
ctggtctgtaagatcttccgtgtctcttggaaggaccgggacagagatgtcatctttctt
tcttctctttctgcacagtttaagcagaacccaaaagaagtattctccgattttaaggac
ttgattggccagattttaatggaagtgctaatgatgtccactcagaccagagatgaaaac
ccatttgccagtctgacagccacatcacagccaattgctgcagcagcacggtcaccagac
agaaatctcttgctaaacactggctccaatccaggaacaagccccatgttctgcagcgtg
gcttcctttggtgccagctctttgtctagcctctatgaaagtagtccggctcccactccc
agtttctggagctctgttcccgtgatgggcccgtctcttgcctcaccttcccgtgcagcc
agccagttggctgtgccttccactcccctcagtcctcacagtgcagcctctggaactgct
gcgggaagccagccttcatccccgcggtatcgcccctacactgtcactcacccatgggcg
tcctcaggcgtctccattctgtcgagctccccaagtccccctgccctcgccagtagcccc
caagcagtgcccgccagcagttccagacagaggcccagcagcacgggtccacccctacca
cccgcctcacccagtgccacgagcagacgcccctcctccctgaggatctctcctagtttg
ggagcctctggtggagcaagtaattgggattcctacagtgaccatttcaccattgaaacc
tgcaaagagacagatatgctgaactacctcatcgagtgtttcgaccgagttggaatagag
gaaaaaaaagcaccaaagatgtgcagccagccagcagtcagccagcttctgagcaacatc
cgctcacagtgcatatcccatactgctttagtactacaaggctccctaacacagcccagg
tccttgcagcagccgtccttcctagtgccgtatatgctgtgtaggaatctcccatatggc
ttcattcaggaactggtgagaaccactcaccaggatgaagaagtgttcaagcagatattt
atccccattttacaaggcctggctcttgctgccaaagagtgctccctcgacagtgactac
tttaaataccccctcatggcactaggtgagctctgtgaaaccaagtttgggaagacacac
cctgtgtgcaatttggttgcttctttgcggttgtggttgccgaaatccttaagtcctggc
tgtgggcgggagctgcagagactctcttacttaggggctttctttagcttctcagtcttt
gcagaagatgatgttaaagtggttgaaaaatacttctcagggcctgccattaccctggaa
aacactcgtgtggttagccaatcattgcagcattacttagagctcggaaggcaagagctt
tttaagattctgcatagtattttgttaaatggcgaaacccgtgaggctgctctcagttac
atggcggctgtcgtcaatgccaatatgaagaaagcacagatgcagacagatgatagattg
gtgtctacagatggatttatgctgaatttcctttgggtactgcagcagctaagtacaaaa
atcaagttagaaacagttgatcccacgtatatttttcacccaagatgtcggattactctt
cccaatgatgagacgcgtgtgaatgcaacgatggaagatgtgaatgactggctgactgaa
ctctatggcgatcagcctccattttctgagccgaaattccctacggagtgcttctttctc
accctgcatgctcaccacctctctattctgcctagttgccgtcgctatatccgcagactc
cgggctatccgggagctcaatagaactgtagaagatttgaaaaataatgaaagccaatgg
aaagattccccactggcaactagacaccgcgaaatgctgaagcgctgtaaaactcagctt
aagaaactggtacggtgcaaggcctgtgctgatgctggcctacttgacgagagcttcctg
agaagatgtctgaatttttatggccttctcattcagctgctgctccgcatcctggacccc
gcatatcccgatataacactgcctttaaattcagatgtccccaaggtatttgcagcgttg
cctgagttttatgtagaagatgttgcagaatttttattttttattgtacaatactctccc
caggcgctttatgagccctgtactcaggatattgtgatgttccttgttgtgatgttgtgc
aaccagaactacatccgaaacccatatttggtggccaaactggtagaagtcatgtttatg
accaaccctgctgttcagccacgaacccagaagttttttgaaatgattgagaaccatcct
ctctccaccaagttgttggtaccttccctgatgaagttttatacagatgttgagcatacc
ggagccaccagtgagttttatgacaagttcacaattcgctatcatattagcaccattttt
aaaagcctttggcaaaacatagctcaccatggcacctttatggaggagttcaactccggg
aagcagtttgttcgctatataaacatgttgataaacgacacgacgtttttgctcgatgaa
agtctggagtctctgaagcgaatccatgaagtgcaggaagagatgaagaacaaagaacag
tgggaccagttgccccgggatcagcagcaggctcgtcagtctcagcttgctcaggatgag
cgtgtgtcccgctcttacctcgccctggccaccgaaaccgtggacatgttccacatcctc
acgaagcaggtccagaagcccttcctcagaccggagcttggaccccgattggctgcaatg
ctgaactttaatcttcagcaactttgtggccccaagtgccgtgacctgaaagttgaaaac
cctgagaaatacggctttgaaccaaagaagctgttggaccaactgacggatatttactta
cagctggactgtgctcggttcgcgaaagccattgctgacgaccagagatcctacagtaag
gaattgtttgaagaagttatttcaaagatgcggaaggcagggatcaaatccacaatagca
atagaaaaatttaagctgctcgccgagaaagtggaggagatagtggccaagaacgcacgc
gcagaaatcgactacagcgacgctcctgatgagttcagagaccctctgatggacaccctc
atgacagaccccgtgcggctgccctctggcaccatcatggaccgctccatcatcctgcgg
cacctgctcaactcccccacggaccccttcaaccggcagacgctgacagagagcatgctg
gaaccagtgccagaactgaaagagcagattcaggcgtggatgagagagaaacagaacagc
gatcactaa

DBGET integrated database retrieval system