KEGG   Homo sapiens (human): 10280Help
Entry
10280             CDS       T01001                                 

Gene name
SIGMAR1, ALS16, DSMA2, OPRS1, SIG-1R, SR-BP, SR-BP1, SRBP, hSigmaR1, sigma1R
Definition
(RefSeq) sigma non-opioid intracellular receptor 1
  KO
K20719  sigma non-opioid intracellular receptor
Organism
hsa  Homo sapiens (human)
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00856  Distal hereditary motor neuropathies (dHMN)
Drug target
Captodiame: D07316
Dextromethorphan (DG01078): D00848 D03742 D03744
Igmesine hydrochloride: D04502
Opipramol (DG00930): D01477 D08297
Rimcazole hydrochloride: D02684
Tiospirone hydrochloride: D02688
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10280 (SIGMAR1)
Transporters [BR:hsa02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   10280 (SIGMAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG2_Sigma1R
Motif
Other DBs
NCBI-GeneID: 10280
NCBI-ProteinID: NP_005857
OMIM: 601978
HGNC: 8157
Ensembl: ENSG00000147955
Vega: OTTHUMG00000019829
Pharos: Q99720(Tclin)
UniProt: Q99720
Structure
PDB: 

Position
9p13.3
AA seq 223 aa AA seqDB search
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggccgtgggccggcggtgggcgtgggccgcgctgctcctggctgtcgcagcg
gtgctgacccaggtcgtctggctctggctgggtacgcagagcttcgtcttccagcgcgaa
gagatagcgcagttggcgcggcagtacgctgggctggaccacgagctggccttctctcgt
ctgatcgtggagctgcggcggctgcacccaggccacgtgctgcccgacgaggagctgcag
tgggtgttcgtgaatgcgggtggctggatgggcgccatgtgccttctgcacgcctcgctg
tccgagtatgtgctgctcttcggcaccgccttgggctcccgcggccactcggggcgctac
tgggctgagatctcggataccatcatctctggcaccttccaccagtggagagagggcacc
accaaaagtgaggtcttctacccaggggagacggtagtacacgggcctggtgaggcaaca
gctgtggagtgggggccaaacacatggatggtggagtacggccggggcgtcatcccatcc
accctggccttcgcgctggccgacactgtcttcagcacccaggacttcctcaccctcttc
tatactcttcgctcctatgctcggggcctccggcttgagctcaccacctacctctttggc
caggacccttga

DBGET integrated database retrieval system