KEGG   Homo sapiens (human): 102800317
Entry
102800317         CDS       T01001                                 

Symbol
TPTEP2-CSNK1E, LOC400927-CSNK1E
Name
(RefSeq) TPTEP2-CSNK1E readthrough
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
hsa04710  Circadian rhythm
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102800317 (TPTEP2-CSNK1E)
   04340 Hedgehog signaling pathway
    102800317 (TPTEP2-CSNK1E)
   04390 Hippo signaling pathway
    102800317 (TPTEP2-CSNK1E)
   04392 Hippo signaling pathway - multiple species
    102800317 (TPTEP2-CSNK1E)
   04068 FoxO signaling pathway
    102800317 (TPTEP2-CSNK1E)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    102800317 (TPTEP2-CSNK1E)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102800317 (TPTEP2-CSNK1E)
   05022 Pathways of neurodegeneration - multiple diseases
    102800317 (TPTEP2-CSNK1E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    102800317 (TPTEP2-CSNK1E)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    102800317 (TPTEP2-CSNK1E)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102800317 (TPTEP2-CSNK1E)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   102800317 (TPTEP2-CSNK1E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102800317 (TPTEP2-CSNK1E)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 102800317
NCBI-ProteinID: NP_001276841
HGNC: 53829
Ensembl: ENSG00000283900
Vega: OTTHUMG00000151135
UniProt: P49674 Q5U045 B3KRV2
Structure
PDB: 
4HNI 4HOK

Position
22q13.1
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagctacgtgtggggaacaagtaccgcctgggacggaagatcgggagcgggtccttc
ggagatatctacctgggtgccaacatcgcctctggtgaggaagtcgccatcaagctggag
tgtgtgaagacaaagcacccccagctgcacatcgagagcaagttctacaagatgatgcag
ggtggcgtggggatcccgtccatcaagtggtgcggagctgagggcgactacaacgtgatg
gtcatggagctgctggggcctagcctcgaggacctgttcaacttctgttcccgcaaattc
agcctcaagacggtgctgctcttggccgaccagatgatcagccgcatcgagtatatccac
tccaagaacttcatccaccgggacgtcaagcccgacaacttcctcatggggctggggaag
aagggcaacctggtctacatcatcgacttcggcctggccaagaagtaccgggacgcccgc
acccaccagcacattccctaccgggaaaacaagaacctgaccggcacggcccgctacgct
tccatcaacacgcacctgggcattgagcaaagccgtcgagatgacctggagagcctgggc
tacgtgctcatgtacttcaacctgggctccctgccctggcaggggctcaaagcagccacc
aagcgccagaagtatgaacggatcagcgagaagaagatgtcaacgcccatcgaggtcctc
tgcaaaggctatccctccgaattctcaacatacctcaacttctgccgctccctgcggttt
gacgacaagcccgactactcttacctacgtcagctcttccgcaacctcttccaccggcag
ggcttctcctatgactacgtctttgactggaacatgctgaaattcggtgcagcccggaat
cccgaggatgtggaccgggagcggcgagaacacgaacgcgaggagaggatggggcagcta
cgggggtccgcgacccgagccctgccccctggcccacccacgggggccactgccaaccgg
ctccgcagtgccgccgagcccgtggcttccacgccagcctcccgcatccagccggctggc
aatacttctcccagagcgatctcgcgggtcgaccgggagaggaaggtgagtatgaggctg
cacaggggtgcgcccgccaacgtctcctcctcagacctcactgggcggcaagaggtctcc
cggatcccagcctcacagacaagtgtgccatttgaccatctcgggaagtga

KEGG   Homo sapiens (human): 122011
Entry
122011            CDS       T01001                                 

Symbol
CSNK1A1L, CK1
Name
(RefSeq) casein kinase 1 alpha 1 like
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    122011 (CSNK1A1L)
   04340 Hedgehog signaling pathway
    122011 (CSNK1A1L)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    122011 (CSNK1A1L)
   05226 Gastric cancer
    122011 (CSNK1A1L)
   05224 Breast cancer
    122011 (CSNK1A1L)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    122011 (CSNK1A1L)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122011 (CSNK1A1L)
   05022 Pathways of neurodegeneration - multiple diseases
    122011 (CSNK1A1L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    122011 (CSNK1A1L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     122011 (CSNK1A1L)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   122011 (CSNK1A1L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 122011
NCBI-ProteinID: NP_660204
HGNC: 20289
Ensembl: ENSG00000180138
Vega: OTTHUMG00000016748
Pharos: Q8N752(Tdark)
UniProt: Q8N752
Position
13q13.3
AA seq 337 aa
MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEDVAVKLESQKVKHPQLLYE
SKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKH
LIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLRAMTKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgacaaacaacagcggctccaaagccgaactcgttgtgggagggaaatacaaactggtg
cggaagatcgggtctggctcctttggagacgtttatctgggcatcaccaccaccaacggc
gaggacgtagcagtgaagctggaatctcagaaggtcaagcacccccagttgctgtatgag
agcaaactctacacgattcttcaaggtggggttggcatcccccacatgcactggtatggt
caggaaaaagacaacaatgtgctagtcatggaccttctgggacccagcctcgaagacctc
tttaatttctgttcaagaaggttcaccatgaaaactgtacttatgttagccgaccagatg
atcagcagaattgaatacgtgcatacaaagaattttctacaccgagacattaaaccagat
aacttcctgatgggtactgggcgtcactgtaataagttgttccttattgattttggtttg
gccaaaaagtacagagacaacaggaccaggcaacacataccgtacagagaagataaacac
ctcattggcactgtccgatatgccagcatcaatgcacatcttggtattgagcagagccgc
cgagatgacatggaatccttaggctacgttttcatgtattttaatagaaccagcctgccg
tggcaaggactaagggctatgacaaaaaaacaaaaatatgaaaagattagtgagaagaag
atgtccacccctgttgaagttttatgtaaggggtttcctgcagaattcgccatgtacttg
aactactgtcgtgggctgcgctttgaggaagtcccagattacatgtatctgaggcagcta
ttccgcattcttttcaggaccctgaaccaccaatatgactacacatttgattggacgatg
ttaaagcagaaagcagcacagcaggcagcctcttccagtgggcagggtcagcaggcccaa
acccagacaggcaagcaaactgaaaaaaacaagaataatgtgaaagataactaa

KEGG   Homo sapiens (human): 1452
Entry
1452              CDS       T01001                                 

Symbol
CSNK1A1, CK1, CK1a, CKIa, HEL-S-77p, HLCDGP1, PRO2975
Name
(RefSeq) casein kinase 1 alpha 1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1452 (CSNK1A1)
   04340 Hedgehog signaling pathway
    1452 (CSNK1A1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    1452 (CSNK1A1)
   05226 Gastric cancer
    1452 (CSNK1A1)
   05224 Breast cancer
    1452 (CSNK1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    1452 (CSNK1A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1452 (CSNK1A1)
   05022 Pathways of neurodegeneration - multiple diseases
    1452 (CSNK1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1452 (CSNK1A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1452 (CSNK1A1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1452 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin APH ABC1 Kdo
Other DBs
NCBI-GeneID: 1452
NCBI-ProteinID: NP_001883
OMIM: 600505
HGNC: 2451
Ensembl: ENSG00000113712
Vega: OTTHUMG00000163463
Pharos: P48729(Tchem)
UniProt: P48729
Structure
PDB: 
6GZD 5FQD

Position
5q32
AA seq 337 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgagtagcagcggctccaaggctgaattcattgtcggagggaaatataaactggta
cggaagatcgggtctggctccttcggggacatctatttggcgatcaacatcaccaacggc
gaggaagtggcagtgaagctagaatctcagaaggccaggcatccccagttgctgtacgag
agcaagctctataagattcttcaaggtggggttggcatcccccacatacggtggtatggt
caggaaaaagactacaatgtactagtcatggatcttctgggacctagcctcgaagacctc
ttcaatttctgttcaagaaggttcacaatgaaaactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagttattccttattgattttggtttg
gccaaaaagtacagagacaacaggacaaggcaacacataccatacagagaagataaaaac
ctcactggcactgcccgatatgctagcatcaatgcacatcttggtattgagcagagtcgc
cgagatgacatggaatcattaggatatgttttgatgtattttaatagaaccagcctgcca
tggcaagggctaaaggctgcaacaaagaaacaaaaatatgaaaagattagtgaaaagaag
atgtccacgcctgttgaagttttatgtaaggggtttcctgcagaatttgcgatgtactta
aactattgtcgtgggctacgctttgaggaagccccagattacatgtatctgaggcagcta
ttccgcattcttttcaggaccctgaaccatcaatatgactacacatttgattggacaatg
ttaaagcagaaagcagcacagcaggcagcctcttccagtgggcagggtcagcaggcccaa
acccccacaggcaagcaaactgacaaaaccaagagtaacatgaaaggtttctaa

KEGG   Homo sapiens (human): 1453
Entry
1453              CDS       T01001                                 

Symbol
CSNK1D, ASPS, CKI-delta, CKId, CKIdelta, FASPS2, HCKID
Name
(RefSeq) casein kinase 1 delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04540  Gap junction
hsa04710  Circadian rhythm
Disease
H00688  Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    1453 (CSNK1D)
   04390 Hippo signaling pathway
    1453 (CSNK1D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    1453 (CSNK1D)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    1453 (CSNK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1453 (CSNK1D)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1453 (CSNK1D)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1453 (CSNK1D)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1453 (CSNK1D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    1453 (CSNK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 1453
NCBI-ProteinID: NP_001884
OMIM: 600864
HGNC: 2452
Ensembl: ENSG00000141551
Vega: OTTHUMG00000178601
Pharos: P48730(Tchem)
UniProt: P48730
Structure
PDB: 

Position
17q25.3
AA seq 415 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagctgagagtcgggaacaggtaccggctgggccggaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcaggagaagaggttgccatcaagcttgaa
tgtgtcaaaaccaaacaccctcagctccacattgagagcaaaatctacaagatgatgcag
ggaggagtgggcatccccaccatcagatggtgcggggcagagggggactacaacgtcatg
gtgatggagctgctggggccaagcctggaggacctcttcaacttctgctccaggaaattc
agcctcaaaaccgtcctgctgcttgctgaccaaatgatcagtcgcatcgaatacattcat
tcaaagaacttcatccaccgggatgtgaagccagacaacttcctcatgggcctggggaag
aagggcaacctggtgtacatcatcgacttcgggctggccaagaagtaccgggatgcacgc
acccaccagcacatcccctatcgtgagaacaagaacctcacggggacggcgcggtacgcc
tccatcaacacgcaccttggaattgaacaatcccgaagagatgacttggagtctctgggc
tacgtgctaatgtacttcaacctgggctctctcccctggcaggggctgaaggctgccacc
aagagacagaaatacgaaaggattagcgagaagaaaatgtccacccccatcgaagtgttg
tgtaaaggctacccttccgaatttgccacatacctgaatttctgccgttccttgcgtttt
gacgacaagcctgactactcgtacctgcggcagcttttccggaatctgttccatcgccag
ggcttctcctatgactacgtgttcgactggaacatgctcaaatttggtgccagccgggcc
gccgatgacgccgagcgggagcgcagggaccgagaggagcggctgagacactcgcggaac
ccggctacccgcggcctcccttccacagcctccggccgcctgcgggggacgcaggaagtg
gctccccccacacccctcacccctacctcacacacggctaacacctccccccggcccgtc
tccggcatggagagagagcggaaagtgagtatgcggctgcaccgcggggcccccgtcaac
atctcctcgtccgacctcacaggccgacaagatacctctcgcatgtccacctcacagatt
cctggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

KEGG   Homo sapiens (human): 1454
Entry
1454              CDS       T01001                                 

Symbol
CSNK1E, CKIe, CKIepsilon, HCKIE
Name
(RefSeq) casein kinase 1 epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
hsa04710  Circadian rhythm
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Drug target
Umbralisib (DG02988): D11322 D11323<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1454 (CSNK1E)
   04340 Hedgehog signaling pathway
    1454 (CSNK1E)
   04390 Hippo signaling pathway
    1454 (CSNK1E)
   04392 Hippo signaling pathway - multiple species
    1454 (CSNK1E)
   04068 FoxO signaling pathway
    1454 (CSNK1E)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    1454 (CSNK1E)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1454 (CSNK1E)
   05022 Pathways of neurodegeneration - multiple diseases
    1454 (CSNK1E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1454 (CSNK1E)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1454 (CSNK1E)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1454 (CSNK1E)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1454 (CSNK1E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    1454 (CSNK1E)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 1454
NCBI-ProteinID: NP_001885
OMIM: 600863
HGNC: 2453
Ensembl: ENSG00000213923
Vega: OTTHUMG00000151135
Pharos: P49674(Tchem)
UniProt: P49674 Q5U045
Structure
PDB: 
4HNI 4HOK

Position
22q13.1
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagctacgtgtggggaacaagtaccgcctgggacggaagatcgggagcgggtccttc
ggagatatctacctgggtgccaacatcgcctctggtgaggaagtcgccatcaagctggag
tgtgtgaagacaaagcacccccagctgcacatcgagagcaagttctacaagatgatgcag
ggtggcgtggggatcccgtccatcaagtggtgcggagctgagggcgactacaacgtgatg
gtcatggagctgctggggcctagcctcgaggacctgttcaacttctgttcccgcaaattc
agcctcaagacggtgctgctcttggccgaccagatgatcagccgcatcgagtatatccac
tccaagaacttcatccaccgggacgtcaagcccgacaacttcctcatggggctggggaag
aagggcaacctggtctacatcatcgacttcggcctggccaagaagtaccgggacgcccgc
acccaccagcacattccctaccgggaaaacaagaacctgaccggcacggcccgctacgct
tccatcaacacgcacctgggcattgagcaaagccgtcgagatgacctggagagcctgggc
tacgtgctcatgtacttcaacctgggctccctgccctggcaggggctcaaagcagccacc
aagcgccagaagtatgaacggatcagcgagaagaagatgtcaacgcccatcgaggtcctc
tgcaaaggctatccctccgaattctcaacatacctcaacttctgccgctccctgcggttt
gacgacaagcccgactactcttacctacgtcagctcttccgcaacctcttccaccggcag
ggcttctcctatgactacgtctttgactggaacatgctgaaattcggtgcagcccggaat
cccgaggatgtggaccgggagcggcgagaacacgaacgcgaggagaggatggggcagcta
cgggggtccgcgacccgagccctgccccctggcccacccacgggggccactgccaaccgg
ctccgcagtgccgccgagcccgtggcttccacgccagcctcccgcatccagccggctggc
aatacttctcccagagcgatctcgcgggtcgaccgggagaggaaggtgagtatgaggctg
cacaggggtgcgcccgccaacgtctcctcctcagacctcactgggcggcaagaggtctcc
cggatcccagcctcacagacaagtgtgccatttgaccatctcgggaagtga

KEGG   Homo sapiens (human): 1455
Entry
1455              CDS       T01001                                 

Symbol
CSNK1G2, CK1g2
Name
(RefSeq) casein kinase 1 gamma 2
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    1455 (CSNK1G2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1455 (CSNK1G2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1455 (CSNK1G2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1455 (CSNK1G2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr CK1gamma_C Pkinase_fungal PIP49_C DUF3580
Other DBs
NCBI-GeneID: 1455
NCBI-ProteinID: NP_001310
OMIM: 602214
HGNC: 2455
Ensembl: ENSG00000133275
Vega: OTTHUMG00000180016
Pharos: P78368(Tchem)
UniProt: P78368
Structure
PDB: 
2C47

Position
19p13.3
AA seq 415 aa
MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKR
QHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSK
NQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggattttgacaagaaaggagggaaaggggagacggaggagggccggagaatgtccaag
gccggcgggggccggagcagccacggcatccggagctcggggaccagctcgggggtcctg
atggtgggccccaacttccgcgtcggcaagaagatcggctgcggcaacttcggggagctc
cgcctaggaaagaatctctatacaaatgaatacgtggctatcaaattggagccgatcaag
tcccgggccccgcagctgcacctggagtaccggttctacaagcagctcagcgccacagag
ggcgtccctcaggtctactacttcggtccgtgcgggaagtacaacgccatggtgctggag
ctgctggggcccagcctggaggacctgttcgacctgtgcgaccggaccttcacgctcaag
acggtgctgatgatcgccatccagctgatcacgcgcatggagtatgtgcacaccaagagc
ctaatctaccgggacgtgaagcccgagaacttcctggtgggccgcccggggaccaagcgg
cagcatgccatccacatcatcgacttcgggctggccaaggagtacatcgaccccgagacc
aagaagcacatcccgtaccgcgagcacaagagcctgacgggcacggcgcgctacatgagc
atcaacacgcacctgggcaaggagcagagccgccgcgacgacctggaggcgctgggccac
atgttcatgtacttcctgcgcggcagcctcccctggcaggggctcaaggccgacacgctc
aaggagcggtaccagaagatcggggacaccaaacgcgccacgcccatcgaggtgctctgc
gagaacttcccagaggagatggccacgtacctgcgctatgtgcggcgcctggacttcttc
gagaagcccgactatgactacctgcggaagctcttcaccgacctcttcgaccgcagtggc
ttcgtgttcgactatgagtacgactgggccgggaagcccctgccgacccccatcggcacc
gtccacaccgacctgccctcccagcctcagctccgggacaaaacccagccgcacagcaaa
aaccaggcgttgaactccaccaacggggagctgaatgcggacgaccccacggccggccac
tccaacgccccgatcacagcgcctgcagaggtggaggtggccgatgaaaccaaatgctgc
tgtttcttcaagaggagaaagagaaaatcgctgcagcgacacaagtga

KEGG   Homo sapiens (human): 1456
Entry
1456              CDS       T01001                                 

Symbol
CSNK1G3, CKI-gamma_3, CSNK1G3L
Name
(RefSeq) casein kinase 1 gamma 3
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    1456 (CSNK1G3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1456 (CSNK1G3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1456 (CSNK1G3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1456 (CSNK1G3)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 1456
NCBI-ProteinID: NP_004375
OMIM: 604253
HGNC: 2456
Ensembl: ENSG00000151292
Vega: OTTHUMG00000128923
Pharos: Q9Y6M4(Tbio)
UniProt: Q9Y6M4
Structure
PDB: 

Position
5q23.2
AA seq 447 aa
MENKKKDKDKSDDRMARPSGRSGHNTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQV
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEMATYLRYVRRLDFFEKPD
YDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRDKMQQSK
NQSADHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSSTNGELNTDDPTAGRSNAPITAP
TEVEVMDETKCCCFFKRRKRKTIQRHK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggaaaataaaaagaaagacaaggacaaatcagatgatagaatggcacgacctagtggt
cgatcgggacacaacactcgaggaactgggtcttcatcgtctggagttttaatggttgga
cctaactttagagttggaaaaaaaattggatgtggcaattttggagaattacgattaggg
aaaaatttatacacaaatgaatatgtggcaattaagttggagcccatgaaatcaagagca
ccacagctacatttggaatacagattctataagcagttaggatctggagatggtatacct
caagtttactatttcggcccttgtggtaaatacaatgctatggtgctggaactgctggga
cctagtttggaagacttgtttgacttgtgtgacagaacattttctcttaaaacagttctc
atgatagctatacaactgatttctcgcatggaatatgtccattcaaagaacttgatatac
agagatgtaaaacctgagaacttcttaataggacgaccaggaaacaaaacccagcaagtt
attcacattatagattttggtttggcaaaggaatatattgatccggagacaaagaaacac
ataccatacagagaacacaagagccttacaggaacagctagatatatgagcataaacaca
catttaggaaaagaacaaagtagaagagacgatttagaagctttaggtcatatgttcatg
tattttctgagaggcagtcttccttggcaaggcttaaaggctgacacattaaaggagagg
tatcagaaaattggagatacaaaacgggctacaccaatagaagtgttatgtgaaaatttt
ccagaaatggcaacatatcttcgttatgtaagaaggctagatttttttgaaaaaccagac
tatgactacttaagaaagctttttactgacttgtttgatcgaaaaggatatatgtttgat
tatgaatatgactggattggtaaacagttgcctactccagtgggtgcagttcagcaagat
cctgctctgtcatcaaacagagaagcacatcaacacagagataagatgcaacaatccaaa
aaccagtcggcagaccacagggcagcttgggactcccagcaggcaaatccccaccatttg
agagctcaccttgcagcagacagacatggtggctcggtacaggttgtaagttctacaaat
ggagagttaaacacagatgaccccaccgcaggacgttcaaatgcacccatcacagcccct
actgaagtagaagtgatggatgaaaccaagtgctgctgttttttcaaacgaaggaaaagg
aaaaccatacagcgccacaaatga

KEGG   Homo sapiens (human): 53944
Entry
53944             CDS       T01001                                 

Symbol
CSNK1G1, CK1gamma1
Name
(RefSeq) casein kinase 1 gamma 1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    53944 (CSNK1G1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    53944 (CSNK1G1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     53944 (CSNK1G1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   53944 (CSNK1G1)
SSDB
Motif
Pfam: Pkinase CK1gamma_C PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 53944
NCBI-ProteinID: NP_001316535
OMIM: 606274
HGNC: 2454
Ensembl: ENSG00000169118
Vega: OTTHUMG00000133019
Pharos: Q9HCP0(Tbio)
UniProt: Q9HCP0 A0A024R5W3
Structure
PDB: 
2CMW

Position
15q22.31
AA seq 422 aa
MDHPSREKDERQRTTKPMAQRSAHCSRPSGSSSSSGVLMVGPNFRVGKKIGCGNFGELRL
GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLEL
LGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKE
HVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM
FMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFE
KPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRP
SQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQR
HK
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggaccatcctagtagggaaaaggatgaaagacaacggacaactaaacccatggcacaa
aggagtgcacactgctctcgaccatctggctcctcatcgtcctctggggttcttatggtg
ggacccaacttcagggttggcaagaagataggatgtgggaacttcggagagctcagatta
ggtaaaaatctctacaccaatgaatatgtagcaatcaaactggaaccaataaaatcacgt
gctccacagcttcatttagagtacagattttataaacagcttggcagtgcaggtgaaggt
ctcccacaggtgtattactttggaccatgtgggaaatataatgccatggtgctggagctc
cttggccctagcttggaggacttgtttgacctctgtgaccgaacatttactttgaagacg
gtgttaatgatagccatccagctgctttctcgaatggaatacgtgcactcaaagaacctc
atttaccgagatgtcaagccagagaacttcctgattggtcgacaaggcaataagaaagag
catgttatacacattatagactttggactggccaaggaatacattgaccccgaaaccaaa
aaacacataccttatagggaacacaaaagtttaactggaactgcaagatatatgtctatc
aacacgcatcttggcaaagagcaaagccggagagatgatttggaagccctaggccatatg
ttcatgtatttccttcgaggcagcctcccctggcaaggactcaaggctgacacattaaaa
gagagatatcaaaaaattggtgacaccaaaaggaatactcccattgaagctctctgtgag
aactttccagaggagatggcaacctaccttcgatatgtcaggcgactggacttctttgaa
aaacctgattatgagtatttacggaccctcttcacagacctctttgaaaagaaaggctac
acctttgactatgcctatgattgggttgggagacctattcctactccagtagggtcagtt
cacgtagattctggtgcatctgcaataactcgagaaagccacacacatagggatcggcca
tcacaacagcagcctcttcgaaatcaggtggttagctcaaccaatggagagctgaatgtt
gatgatcccacgggagcccactccaatgcaccaatcacagctcatgccgaggtggaggta
gtggaggaagctaagtgctgctgtttctttaagaggaaaaggaagaagactgctcagcgc
cacaagtga

DBGET integrated database retrieval system