KEGG   Homo sapiens (human): 102800317
Entry
102800317         CDS       T01001                                 

Gene name
TPTEP2-CSNK1E, LOC400927-CSNK1E
Definition
(RefSeq) TPTEP2-CSNK1E readthrough
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
hsa04710  Circadian rhythm
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102800317 (TPTEP2-CSNK1E)
   04340 Hedgehog signaling pathway
    102800317 (TPTEP2-CSNK1E)
   04390 Hippo signaling pathway
    102800317 (TPTEP2-CSNK1E)
   04392 Hippo signaling pathway - multiple species
    102800317 (TPTEP2-CSNK1E)
   04068 FoxO signaling pathway
    102800317 (TPTEP2-CSNK1E)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    102800317 (TPTEP2-CSNK1E)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102800317 (TPTEP2-CSNK1E)
   05022 Pathways of neurodegeneration - multiple diseases
    102800317 (TPTEP2-CSNK1E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    102800317 (TPTEP2-CSNK1E)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    102800317 (TPTEP2-CSNK1E)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102800317 (TPTEP2-CSNK1E)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   102800317 (TPTEP2-CSNK1E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102800317 (TPTEP2-CSNK1E)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 102800317
NCBI-ProteinID: NP_001276841
HGNC: 53829
Ensembl: ENSG00000283900
Vega: OTTHUMG00000151135
UniProt: P49674 Q5U045 B3KRV2
Structure
PDB: 
4HNI 4HOK

Position
22q13.1
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagctacgtgtggggaacaagtaccgcctgggacggaagatcgggagcgggtccttc
ggagatatctacctgggtgccaacatcgcctctggtgaggaagtcgccatcaagctggag
tgtgtgaagacaaagcacccccagctgcacatcgagagcaagttctacaagatgatgcag
ggtggcgtggggatcccgtccatcaagtggtgcggagctgagggcgactacaacgtgatg
gtcatggagctgctggggcctagcctcgaggacctgttcaacttctgttcccgcaaattc
agcctcaagacggtgctgctcttggccgaccagatgatcagccgcatcgagtatatccac
tccaagaacttcatccaccgggacgtcaagcccgacaacttcctcatggggctggggaag
aagggcaacctggtctacatcatcgacttcggcctggccaagaagtaccgggacgcccgc
acccaccagcacattccctaccgggaaaacaagaacctgaccggcacggcccgctacgct
tccatcaacacgcacctgggcattgagcaaagccgtcgagatgacctggagagcctgggc
tacgtgctcatgtacttcaacctgggctccctgccctggcaggggctcaaagcagccacc
aagcgccagaagtatgaacggatcagcgagaagaagatgtcaacgcccatcgaggtcctc
tgcaaaggctatccctccgaattctcaacatacctcaacttctgccgctccctgcggttt
gacgacaagcccgactactcttacctacgtcagctcttccgcaacctcttccaccggcag
ggcttctcctatgactacgtctttgactggaacatgctgaaattcggtgcagcccggaat
cccgaggatgtggaccgggagcggcgagaacacgaacgcgaggagaggatggggcagcta
cgggggtccgcgacccgagccctgccccctggcccacccacgggggccactgccaaccgg
ctccgcagtgccgccgagcccgtggcttccacgccagcctcccgcatccagccggctggc
aatacttctcccagagcgatctcgcgggtcgaccgggagaggaaggtgagtatgaggctg
cacaggggtgcgcccgccaacgtctcctcctcagacctcactgggcggcaagaggtctcc
cggatcccagcctcacagacaagtgtgccatttgaccatctcgggaagtga

KEGG   Homo sapiens (human): 1453
Entry
1453              CDS       T01001                                 

Gene name
CSNK1D, ASPS, CKI-delta, CKId, CKIdelta, FASPS2, HCKID
Definition
(RefSeq) casein kinase 1 delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04540  Gap junction
hsa04710  Circadian rhythm
Disease
H00688  Familial advanced sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    1453 (CSNK1D)
   04390 Hippo signaling pathway
    1453 (CSNK1D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    1453 (CSNK1D)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    1453 (CSNK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1453 (CSNK1D)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1453 (CSNK1D)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1453 (CSNK1D)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1453 (CSNK1D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    1453 (CSNK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 1453
NCBI-ProteinID: NP_001884
OMIM: 600864
HGNC: 2452
Ensembl: ENSG00000141551
Vega: OTTHUMG00000178601
Pharos: P48730(Tchem)
UniProt: P48730
Structure
PDB: 

Position
17q25.3
AA seq 415 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagctgagagtcgggaacaggtaccggctgggccggaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcaggagaagaggttgccatcaagcttgaa
tgtgtcaaaaccaaacaccctcagctccacattgagagcaaaatctacaagatgatgcag
ggaggagtgggcatccccaccatcagatggtgcggggcagagggggactacaacgtcatg
gtgatggagctgctggggccaagcctggaggacctcttcaacttctgctccaggaaattc
agcctcaaaaccgtcctgctgcttgctgaccaaatgatcagtcgcatcgaatacattcat
tcaaagaacttcatccaccgggatgtgaagccagacaacttcctcatgggcctggggaag
aagggcaacctggtgtacatcatcgacttcgggctggccaagaagtaccgggatgcacgc
acccaccagcacatcccctatcgtgagaacaagaacctcacggggacggcgcggtacgcc
tccatcaacacgcaccttggaattgaacaatcccgaagagatgacttggagtctctgggc
tacgtgctaatgtacttcaacctgggctctctcccctggcaggggctgaaggctgccacc
aagagacagaaatacgaaaggattagcgagaagaaaatgtccacccccatcgaagtgttg
tgtaaaggctacccttccgaatttgccacatacctgaatttctgccgttccttgcgtttt
gacgacaagcctgactactcgtacctgcggcagcttttccggaatctgttccatcgccag
ggcttctcctatgactacgtgttcgactggaacatgctcaaatttggtgccagccgggcc
gccgatgacgccgagcgggagcgcagggaccgagaggagcggctgagacactcgcggaac
ccggctacccgcggcctcccttccacagcctccggccgcctgcgggggacgcaggaagtg
gctccccccacacccctcacccctacctcacacacggctaacacctccccccggcccgtc
tccggcatggagagagagcggaaagtgagtatgcggctgcaccgcggggcccccgtcaac
atctcctcgtccgacctcacaggccgacaagatacctctcgcatgtccacctcacagatt
cctggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

KEGG   Homo sapiens (human): 1454
Entry
1454              CDS       T01001                                 

Gene name
CSNK1E, CKIe, CKIepsilon, HCKIE
Definition
(RefSeq) casein kinase 1 epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
hsa04710  Circadian rhythm
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Drug target
Umbralisib (DG02988): D11322 D11323<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1454 (CSNK1E)
   04340 Hedgehog signaling pathway
    1454 (CSNK1E)
   04390 Hippo signaling pathway
    1454 (CSNK1E)
   04392 Hippo signaling pathway - multiple species
    1454 (CSNK1E)
   04068 FoxO signaling pathway
    1454 (CSNK1E)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    1454 (CSNK1E)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1454 (CSNK1E)
   05022 Pathways of neurodegeneration - multiple diseases
    1454 (CSNK1E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1454 (CSNK1E)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1454 (CSNK1E)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1454 (CSNK1E)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1454 (CSNK1E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    1454 (CSNK1E)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 1454
NCBI-ProteinID: NP_001885
OMIM: 600863
HGNC: 2453
Ensembl: ENSG00000213923
Vega: OTTHUMG00000151135
Pharos: P49674(Tchem)
UniProt: P49674 Q5U045
Structure
PDB: 
4HNI 4HOK

Position
22q13.1
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagctacgtgtggggaacaagtaccgcctgggacggaagatcgggagcgggtccttc
ggagatatctacctgggtgccaacatcgcctctggtgaggaagtcgccatcaagctggag
tgtgtgaagacaaagcacccccagctgcacatcgagagcaagttctacaagatgatgcag
ggtggcgtggggatcccgtccatcaagtggtgcggagctgagggcgactacaacgtgatg
gtcatggagctgctggggcctagcctcgaggacctgttcaacttctgttcccgcaaattc
agcctcaagacggtgctgctcttggccgaccagatgatcagccgcatcgagtatatccac
tccaagaacttcatccaccgggacgtcaagcccgacaacttcctcatggggctggggaag
aagggcaacctggtctacatcatcgacttcggcctggccaagaagtaccgggacgcccgc
acccaccagcacattccctaccgggaaaacaagaacctgaccggcacggcccgctacgct
tccatcaacacgcacctgggcattgagcaaagccgtcgagatgacctggagagcctgggc
tacgtgctcatgtacttcaacctgggctccctgccctggcaggggctcaaagcagccacc
aagcgccagaagtatgaacggatcagcgagaagaagatgtcaacgcccatcgaggtcctc
tgcaaaggctatccctccgaattctcaacatacctcaacttctgccgctccctgcggttt
gacgacaagcccgactactcttacctacgtcagctcttccgcaacctcttccaccggcag
ggcttctcctatgactacgtctttgactggaacatgctgaaattcggtgcagcccggaat
cccgaggatgtggaccgggagcggcgagaacacgaacgcgaggagaggatggggcagcta
cgggggtccgcgacccgagccctgccccctggcccacccacgggggccactgccaaccgg
ctccgcagtgccgccgagcccgtggcttccacgccagcctcccgcatccagccggctggc
aatacttctcccagagcgatctcgcgggtcgaccgggagaggaaggtgagtatgaggctg
cacaggggtgcgcccgccaacgtctcctcctcagacctcactgggcggcaagaggtctcc
cggatcccagcctcacagacaagtgtgccatttgaccatctcgggaagtga

DBGET integrated database retrieval system