KEGG   Homo sapiens (human): 10287Help
Entry
10287             CDS       T01001                                 

Gene name
RGS19, GAIP, RGSGAIP
Definition
(RefSeq) regulator of G protein signaling 19
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    10287 (RGS19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS
Motif
Other DBs
NCBI-GeneID: 10287
NCBI-ProteinID: NP_001034556
OMIM: 605071
HGNC: 13735
Ensembl: ENSG00000171700
Vega: OTTHUMG00000033024
Pharos: P49795(Tbio)
UniProt: P49795
Structure
PDB: 

Position
20q13.33
AA seq 217 aa AA seqDB search
MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQ
ASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFW
LACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDA
QLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccccgcatgaggctgagaagcagatcacagggccagaggaggcggaccggccc
ccttcaatgtccagtcatgatacagcctctccagcggcccccagccgcaacccctgctgc
ctgtgctggtgctgctgctgtagctgctcctggaaccaagagcggcggcgcgcgtggcag
gcctcccgggagagcaagctgcagcccctccccagctgtgaagtatgtgccacgccaagt
cctgaggaggtgcagagctgggcgcagtcttttgacaagctgatgcacagcccagcggga
cgcagcgtgttccgggcgttcctgcggacagagtacagcgaggagaacatgctcttctgg
ttggcctgcgaggagctgaaggccgaggccaaccagcatgtggtagacgagaaggcgagg
ctcatctacgaggactacgtatccatcctgtcccccaaggaggtgagcctggactcccgt
gtgcgggagggcatcaacaagaagatgcaggagccgtccgcacacacgttcgacgacgcg
cagctgcagatctacacgctcatgcaccgggactcctacccccgcttcctcagctctccc
acctaccgtgccctgctgctgcaggggccatcacagtcctcctccgaggcctag

DBGET integrated database retrieval system