KEGG   Homo sapiens (human): 1029Help
Entry
1029              CDS       T01001                                 

Gene name
CDKN2A, ARF, CDK4I, CDKN2, CMM2, INK4, INK4A, MLM, MTS-1, MTS1, P14, P14ARF, P16, P16-INK4A, P16INK4, P16INK4A, P19, P19ARF, TP16
Definition
(RefSeq) cyclin dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04218  Cellular senescence
hsa04934  Cushing syndrome
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05212  Pancreatic cancer
hsa05214  Glioma
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
Network
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00222  HTLV-1 Tax to host-cell-protein inhibition
Disease
H00004  Chronic myeloid leukemia (CML)
H00008  Burkitt lymphoma
H00009  Adult T-cell leukemia
H00014  Non-small cell lung cancer
H00015  Malignant pleural mesothelioma
H00016  Oral cancer
H00017  Esophageal cancer
H00019  Pancreatic cancer
H00022  Bladder cancer
H00025  Penile cancer
H00036  Osteosarcoma
H00038  Melanoma
H00040  Squamous cell carcinoma
H00042  Glioma
H00046  Cholangiocarcinoma
H00047  Gallbladder cancer
H00048  Hepatocellular carcinoma
H00054  Nasopharyngeal cancer
H00055  Laryngeal cancer
H00409  Type 2 diabetes mellitus
H01463  Mycosis fungoides
H01464  Mantle cell lymphoma
H01508  Salivary gland cancer
H01509  Tonsillar cancer
H01513  Retinoblastoma
H01556  Meningioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1029 (CDKN2A)
   04115 p53 signaling pathway
    1029 (CDKN2A)
   04218 Cellular senescence
    1029 (CDKN2A)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    1029 (CDKN2A)
   05206 MicroRNAs in cancer
    1029 (CDKN2A)
   05203 Viral carcinogenesis
    1029 (CDKN2A)
  09162 Cancers: Specific types
   05212 Pancreatic cancer
    1029 (CDKN2A)
   05225 Hepatocellular carcinoma
    1029 (CDKN2A)
   05214 Glioma
    1029 (CDKN2A)
   05220 Chronic myeloid leukemia
    1029 (CDKN2A)
   05218 Melanoma
    1029 (CDKN2A)
   05219 Bladder cancer
    1029 (CDKN2A)
   05223 Non-small cell lung cancer
    1029 (CDKN2A)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    1029 (CDKN2A)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    1029 (CDKN2A)
   05163 Human cytomegalovirus infection
    1029 (CDKN2A)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    1029 (CDKN2A)
   01522 Endocrine resistance
    1029 (CDKN2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank
Motif
Other DBs
NCBI-GeneID: 1029
NCBI-ProteinID: NP_000068
OMIM: 600160
HGNC: 1787
Ensembl: ENSG00000147889
Vega: OTTHUMG00000019686
Pharos: P42771(Tbio)
UniProt: P42771 K7PML8
Structure
PDB: 

Position
9p21.3
AA seq 156 aa AA seqDB search
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA
ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE
LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggagccggcggcggggagcagcatggagccttcggctgactggctggccacggccgcg
gcccggggtcgggtagaggaggtgcgggcgctgctggaggcgggggcgctgcccaacgca
ccgaatagttacggtcggaggccgatccaggtcatgatgatgggcagcgcccgagtggcg
gagctgctgctgctccacggcgcggagcccaactgcgccgaccccgccactctcacccga
cccgtgcacgacgctgcccgggagggcttcctggacacgctggtggtgctgcaccgggcc
ggggcgcggctggacgtgcgcgatgcctggggccgtctgcccgtggacctggctgaggag
ctgggccatcgcgatgtcgcacggtacctgcgcgcggctgcggggggcaccagaggcagt
aaccatgcccgcatagatgccgcggaaggtccctcagacatccccgattga

DBGET integrated database retrieval system