KEGG   Homo sapiens (human): 10293
Entry
10293             CDS       T01001                                 

Gene name
TRAIP, RNF206, SCKL9, TRIP
Definition
(RefSeq) TRAF interacting protein
  KO
K11985  TRAF-interacting protein [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Disease
H00992  Seckel syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10293 (TRAIP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     10293 (TRAIP)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    10293 (TRAIP)
SSDB
Motif
Pfam: zf-RING_2 zf-C3HC4_2 zf-rbx1 zf-C3HC4 zf-RING_UBOX zf-C3HC4_4 zf-RING_5 zf-C3HC4_3 WEMBL zf-ANAPC11 zf-RING_11 Spc7 Zn_ribbon_17 MscS_porin HMMR_N Crescentin HIP1_clath_bdg zf-RING-like FANCL_C GAS Zn-ribbon_8 DUF745 Laminin_II YqgF
Other DBs
NCBI-GeneID: 10293
NCBI-ProteinID: NP_005870
OMIM: 605958
HGNC: 30764
Ensembl: ENSG00000183763
Vega: OTTHUMG00000158269
Pharos: Q9BWF2(Tbio)
UniProt: Q9BWF2
Position
3p21.31
AA seq 469 aa
MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIIN
KLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVS
LQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEV
EEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVY
SELDQAKLELKSAQKDLQSADKEIMSLKKKLTMLQETLNLPPVASETVDRLVLESPAPVE
VNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQDVPKKICKGP
RKESQLSLGGQSCAGEPDEELVGAFPIFVRNAILGQKQPKRPRSESSCSKDVVRTGFDGL
GGRTKFIQPTDTVMIRPLPVKPKTKVKQRVRVKTVPSLFQAKLDTFLWS
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgcctatccgtgctctgtgcactatctgctccgacttcttcgatcactcccgcgacgtg
gccgccatccactgcggccacaccttccacttgcagtgcctaattcagtggtttgagaca
gcaccaagtcggacctgcccacagtgccgaatccaggttggcaaaagaaccattatcaat
aagctcttctttgatcttgcccaggaggaggagaatgtcttggatgcagaattcttaaag
aatgaactggacaatgtcagagcccagctttcccagaaagacaaggagaaacgagacagc
caggtcatcatcgacactctgcgggatacgctggaagaacgcaatgctactgtggtatct
ctgcagcaggccttgggcaaggccgagatgctgtgctccacactgaaaaagcagatgaag
tacttagagcagcagcaggatgagaccaaacaagcacaagaggaggcccgccggctcagg
agcaagatgaagaccatggagcagattgagcttctactccagagccagcgccctgaggtg
gaggagatgatccgagacatgggtgtgggacagtcagcggtggaacagctggctgtgtac
tgtgtgtctctcaagaaagagtacgagaatctaaaagaggcacggaaggcctcaggggag
gtggctgacaagctgaggaaggatttgttttcctccagaagcaagttgcagacagtctac
tctgaattggatcaggccaagttagaactgaagtcagcccagaaggacttacagagtgct
gacaaggaaatcatgagcctgaaaaagaagctaacgatgctgcaggaaaccttgaacctg
ccaccagtggccagtgagactgtcgaccgcctggttttagagagcccagcccctgtggag
gtgaatctgaagctccgccggccatccttccgtgatgatattgatctcaatgctaccttt
gatgtggatactcccccagcccggccctccagctcccagcatggttactacgaaaaactt
tgcctagagaagtcacactccccaattcaggatgtccccaagaagatatgcaaaggcccc
aggaaggagtcccagctctcactgggtggccagagctgtgcaggagagccagatgaggaa
ctggttggtgccttccctatttttgtccggaatgccatcctaggccagaaacagcccaag
aggcccaggtcagagtcctcttgcagcaaagatgtggtaaggacaggcttcgatgggctc
ggtggccggacaaaattcatccagcctactgacacagtcatgatccgcccattgcctgtt
aagcccaagaccaaggttaagcagagggtgagggtgaagacagtgccttctctcttccag
gccaagctggacaccttcctgtggtcgtga

DBGET integrated database retrieval system