KEGG   Homo sapiens (human): 10294Help
Entry
10294             CDS       T01001                                 

Gene name
DNAJA2, CPR3, DJ3, DJA2, DNAJ, DNJ3, HIRIP4, PRO3015, RDJ2
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member A2
  KO
K09503  DnaJ homolog subfamily A member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10294 (DNAJA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10294 (DNAJA2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10294 (DNAJA2)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   10294 (DNAJA2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    10294 (DNAJA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Motif
Other DBs
NCBI-GeneID: 10294
NCBI-ProteinID: NP_005871
OMIM: 611322
HGNC: 14884
Ensembl: ENSG00000069345
Vega: OTTHUMG00000133104
Pharos: O60884(Tbio)
UniProt: O60884 A0A024R6S1
Position
16q11.2
AA seq 412 aa AA seqDB search
MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNP
EKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPL
KVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQ
QMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQA
PGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPP
GKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPE
VPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgtggctgacacgaagctgtacgacatcctgggcgtcccgcccggcgccagc
gagaacgagctgaagaaggcatacagaaagttagccaaggaatatcatcctgataagaat
ccaaatgcaggagacaaatttaaagaaataagttttgcatatgaagtactatcaaatcct
gagaagcgtgagttatatgacagatacggagagcaaggtcttcgggaaggcagcggcgga
ggtggtggcatggatgatattttctctcacatttttggtgggggattgttcggcttcatg
ggcaatcagagtagaagtcgaaatggcagaagaagaggagaggacatgatgcatccactc
aaagtatctttagaagatctgtataatggcaagacaaccaaactacaacttagcaagaat
gtgctctgtagtgcatgcagtggccaaggcggaaagtctggagctgtccaaaagtgtagt
gcttgtcgaggtcgaggtgtgcgcatcatgatcagacagctggctccagggatggtacaa
cagatgcagtctgtgtgctctgattgtaatggagaaggagaggtaattaatgaaaaagac
cgctgtaaaaaatgtgaagggaagaaggtgattaaagaagtcaagattcttgaagtccac
gtagacaaaggcatgaaacatggacagagaattacattcactggggaagcagaccaggcc
ccaggagtggaacccggagacattgttcttttgctacaggagaaagaacatgaggtattt
cagagagatgggaatgatttgcacatgacatataaaataggacttgttgaagctctatgt
ggatttcagttcacatttaagcaccttgatggacgtcagattgtggtgaaatacccccct
ggcaaagtaattgaaccagggtgtgttcgtgtagttcgaggtgaagggatgccgcagtat
cgtaatccctttgaaaaaggtgatctttacataaagtttgatgtgcagtttcctgaaaac
aactggatcaacccagacaagctttctgaactagaagatcttctgccatctagaccggaa
gttcctaacataattggagaaacagaggaggtagagcttcaggaatttgatagcactcga
ggctcaggaggtggtcagaggcgtgaagcctataatgatagctctgatgaagaaagcagc
agccatcatggacctggagtgcagtgtgcccatcagtaa

DBGET integrated database retrieval system