KEGG   Homo sapiens (human): 10294
Entry
10294             CDS       T01001                                 

Symbol
DNAJA2, CPR3, DJ3, DJA2, DNAJ, DNJ3, HIRIP4, PRO3015, RDJ2
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member A2
  KO
K09503  DnaJ homolog subfamily A member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10294 (DNAJA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10294 (DNAJA2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10294 (DNAJA2)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   10294 (DNAJA2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    10294 (DNAJA2)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Other DBs
NCBI-GeneID: 10294
NCBI-ProteinID: NP_005871
OMIM: 611322
HGNC: 14884
Ensembl: ENSG00000069345
Vega: OTTHUMG00000133104
Pharos: O60884(Tbio)
UniProt: O60884 A0A024R6S1
Position
16q11.2
AA seq 412 aa
MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNP
EKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPL
KVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQ
QMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQA
PGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPP
GKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPE
VPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggctaacgtggctgacacgaagctgtacgacatcctgggcgtcccgcccggcgccagc
gagaacgagctgaagaaggcatacagaaagttagccaaggaatatcatcctgataagaat
ccaaatgcaggagacaaatttaaagaaataagttttgcatatgaagtactatcaaatcct
gagaagcgtgagttatatgacagatacggagagcaaggtcttcgggaaggcagcggcgga
ggtggtggcatggatgatattttctctcacatttttggtgggggattgttcggcttcatg
ggcaatcagagtagaagtcgaaatggcagaagaagaggagaggacatgatgcatccactc
aaagtatctttagaagatctgtataatggcaagacaaccaaactacaacttagcaagaat
gtgctctgtagtgcatgcagtggccaaggcggaaagtctggagctgtccaaaagtgtagt
gcttgtcgaggtcgaggtgtgcgcatcatgatcagacagctggctccagggatggtacaa
cagatgcagtctgtgtgctctgattgtaatggagaaggagaggtaattaatgaaaaagac
cgctgtaaaaaatgtgaagggaagaaggtgattaaagaagtcaagattcttgaagtccac
gtagacaaaggcatgaaacatggacagagaattacattcactggggaagcagaccaggcc
ccaggagtggaacccggagacattgttcttttgctacaggagaaagaacatgaggtattt
cagagagatgggaatgatttgcacatgacatataaaataggacttgttgaagctctatgt
ggatttcagttcacatttaagcaccttgatggacgtcagattgtggtgaaatacccccct
ggcaaagtaattgaaccagggtgtgttcgtgtagttcgaggtgaagggatgccgcagtat
cgtaatccctttgaaaaaggtgatctttacataaagtttgatgtgcagtttcctgaaaac
aactggatcaacccagacaagctttctgaactagaagatcttctgccatctagaccggaa
gttcctaacataattggagaaacagaggaggtagagcttcaggaatttgatagcactcga
ggctcaggaggtggtcagaggcgtgaagcctataatgatagctctgatgaagaaagcagc
agccatcatggacctggagtgcagtgtgcccatcagtaa

KEGG   Homo sapiens (human): 285126
Entry
285126            CDS       T01001                                 

Symbol
DNAJC5G, CSP-gamma
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member C5 gamma
  KO
K09525  DnaJ homolog subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    285126 (DNAJC5G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    285126 (DNAJC5G)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   285126 (DNAJC5G)
SSDB
Motif
Pfam: DnaJ CCER1
Other DBs
NCBI-GeneID: 285126
NCBI-ProteinID: NP_001290056
OMIM: 613946
HGNC: 24844
Ensembl: ENSG00000163793
Vega: OTTHUMG00000097079
Pharos: Q8N7S2(Tdark)
UniProt: Q8N7S2
Position
2p23.3
AA seq 189 aa
MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRY
HPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILN
SCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFR
SEENSEDDF
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtctactgtgaaggaagcagcacaccggctgtccaaaagtgagatgagcctctatgca
gtgctggatcttaagaagggcgcctcacctgaagacttcaaaaaatcctacagccattcc
gcattgcttccccaccctccttttgagtatcacctgggtaggaaactggccttgcggtat
catcccgacaagaatccagggaatgctcaagcagcagaaatattcaaagagatcaacgca
gctcatgccatactgagcgactctaagaagcggaaaatttacgaccagcatggctcattg
ggaatatatctgtatgatcactttggtgaagaaggcgtcagatactattttattctgaat
agttgttggttcaagacacttgtcatcctgtgtactctgctcacttgttgctgtttctgt
tgttgctgctgtttttgctgtggagcacttaaaccaccacctgagcaggatagtgggaga
aaatatcagcagaatgtccagagtcagcctccaaggtcaggagccaaatgtgattttaga
agcgaggaaaatagcgaagatgatttttaa

KEGG   Homo sapiens (human): 3300
Entry
3300              CDS       T01001                                 

Symbol
DNAJB2, CMT2T, DSMA5, HSJ-1, HSJ1, HSPF3
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member B2
  KO
K09508  DnaJ homolog subfamily B member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00856  Distal hereditary motor neuropathies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3300 (DNAJB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3300 (DNAJB2)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   3300 (DNAJB2)
SSDB
Motif
Pfam: DnaJ UIM RPT
Other DBs
NCBI-GeneID: 3300
NCBI-ProteinID: NP_006727
OMIM: 604139
HGNC: 5228
Ensembl: ENSG00000135924
Vega: OTTHUMG00000133134
Pharos: P25686(Tbio)
UniProt: P25686
Structure
PDB: 
2LGW

Position
2q35
AA seq 324 aa
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKH
KREIYDRYGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDL
GPFSELQNRGSRHSGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRIT
TRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSRSGGTQVQQTP
ASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQ
EGARGEATKRSPSPEEKASRCLIL
NT seq 975 nt   +upstreamnt  +downstreamnt
atggcatcctactacgagatcctagacgtgccgcgaagtgcgtccgctgatgacatcaag
aaggcgtatcggcgcaaggctctccagtggcacccagacaaaaacccagataataaagag
tttgctgagaagaaatttaaggaggtggccgaggcatatgaagtgctgtctgacaagcac
aagcgggagatttacgaccgctatggccgggaagggctgacagggacaggaactggccca
tctcgggcagaagctggcagtggtgggcctggcttcaccttcaccttccgcagccccgag
gaggtcttccgggaattctttgggagtggagacccttttgcagagctctttgatgacctg
ggccccttctcagagcttcagaaccggggttcccgacactcaggccccttctttaccttc
tcttcctccttccctgggcactccgatttctcctcctcatctttctccttcagtcctggg
gctggtgcttttcgctctgtttctacatctaccacctttgtccaaggacgccgcatcacc
acacgcagaatcatggagaacgggcaggagcgggtggaagtggaggaggatgggcagctg
aagtcagtcacaatcaatggtgtcccagatgacctggcactgggcttggagctgagccgt
cgcgagcagcagccgtcagtcacttccaggtctgggggcactcaggtccagcagacccct
gcctcatgccccttggacagcgacctctctgaggatgaggacctgcagctggccatggcc
tacagcctgtcagagatggaggcagctgggaagaaacccgcaggtgggcgggaggcacag
caccgacggcaggggcggcccaaggcccagcaccaagatccaggcttgggggggacccag
gagggtgcgaggggtgaagcaaccaaacgcagtccatccccagaggagaaggcctctcgc
tgcctcatcctctga

KEGG   Homo sapiens (human): 3301
Entry
3301              CDS       T01001                                 

Symbol
DNAJA1, DJ-2, DjA1, HDJ2, HSDJ, HSJ-2, HSJ2, HSPF4, NEDD7, hDJ-2
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member A1
  KO
K09502  DnaJ homolog subfamily A member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3301 (DNAJA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3301 (DNAJA1)
   04131 Membrane trafficking [BR:hsa04131]
    3301 (DNAJA1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   3301 (DNAJA1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    3301 (DNAJA1)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Other DBs
NCBI-GeneID: 3301
NCBI-ProteinID: NP_001530
OMIM: 602837
HGNC: 5229
Ensembl: ENSG00000086061
Vega: OTTHUMG00000019760
Pharos: P31689(Tchem)
UniProt: P31689
Structure
PDB: 
2M6Y 2LO1

Position
9p21.1
AA seq 397 aa
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggtgaaagaaacaacttactacgatgttttgggggtcaaacccaatgctactcaggaa
gaattgaaaaaggcttataggaaactggctttgaagtaccatcctgataagaacccaaat
gaaggagagaagtttaaacagatttctcaagcttacgaagttctctctgatgcaaagaaa
agggaattatatgacaaaggaggagaacaggcaattaaagagggtggagcaggtggcggt
tttggctcccccatggacatctttgatatgttttttggaggaggaggaaggatgcagaga
gaaaggagaggtaaaaatgttgtacatcagctctcagtaaccctagaagacttatataat
ggtgcaacaagaaaactggctctgcaaaagaatgtgatttgtgacaaatgtgaaggtaga
ggaggtaagaaaggagcagtagagtgctgtcccaattgccgaggtactggaatgcaaata
agaattcatcagataggacctggaatggttcagcaaattcagtctgtgtgcatggagtgc
cagggccatggggagcggatcagtcctaaagatagatgtaaaagctgcaacggaaggaag
atagttcgagagaagaaaattttagaagttcatattgacaaaggcatgaaagatggccag
aagataacattccatggtgaaggagaccaagaaccaggactggagccaggcgatattatc
attgtgttagatcagaaggaccatgctgtttttactcgacgaggagaagaccttttcatg
tgtatggacatacagctcgttgaagcactgtgtggcttccagaagccaatatctactctt
gacaaccgaaccatcgtcatcacctctcatccaggtcagattgtcaagcatggagatatc
aagtgtgtactaaatgaaggcatgccaatttatcgtagaccatatgaaaagggtcgccta
atcatcgaatttaaggtaaactttcctgagaatggctttctctctcctgataaactgtct
ttgctggaaaaactcctacccgagaggaaggaagtggaagagactgatgagatggaccaa
gtagaactggtggactttgatccaaatcaggaaagacggcgccactacaatggagaagca
tatgaggatgatgaacatcatcccagaggtggtgttcagtgtcagacctcttaa

KEGG   Homo sapiens (human): 3337
Entry
3337              CDS       T01001                                 

Symbol
DNAJB1, HSPF1, Hdj1, Hsp40, RSPH16B, Sis1
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member B1
  KO
K09507  DnaJ homolog subfamily B member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05164  Influenza A
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06170  Influenza A virus (IAV)
  Element
N00726  IAV NP to PKR-eIF2alpha signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3337 (DNAJB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    3337 (DNAJB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3337 (DNAJB1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   3337 (DNAJB1)
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-GeneID: 3337
NCBI-ProteinID: NP_006136
OMIM: 604572
HGNC: 5270
Ensembl: ENSG00000132002
Vega: OTTHUMG00000183289
Pharos: P25685(Tbio)
UniProt: P25685 Q6FHS4
Structure
PDB: 
3AGX 3AGY 3AGZ 2QLD 1HDJ

Position
19p13.12
AA seq 340 aa
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRN
GEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCT
KKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLK
DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
GLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggtaaagactactaccagacgttgggcctggcccgcggcgcgtcggacgaggagatc
aagcgggcctaccgccgccaggcgctgcgctaccacccggacaagaacaaggagcccggc
gccgaggagaagttcaaggagatcgctgaggcctacgacgtgctcagcgacccgcgcaag
cgcgagatcttcgaccgctacggggaggaaggcctaaaggggagtggccccagtggcggt
agcggcggtggtgccaatggtacctctttcagctacacattccatggagaccctcatgcc
atgtttgctgagttcttcggtggcagaaatccctttgacaccttttttgggcagcggaac
ggggaggaaggcatggacattgatgacccattctctggcttccctatgggcatgggtggc
ttcaccaacgtgaactttggccgctcccgctctgcccaagagcccgcccgaaagaagcaa
gatcccccagtcacccacgaccttcgagtctcccttgaagagatctacagcggctgtacc
aagaagatgaaaatctcccacaagcggctaaaccccgacggaaagagcattcgaaacgaa
gacaaaatattgaccatcgaagtgaagaaggggtggaaagaaggaaccaaaatcactttc
cccaaggaaggagaccagacctccaacaacattccagctgatatcgtctttgttttaaag
gacaagccccacaatatctttaagagagatggctctgatgtcatttatcctgccaggatc
agcctccgggaggctctgtgtggctgcacagtgaacgtccccactctggacggcaggacg
atacccgtcgtattcaaagatgttatcaggcctggcatgcggcgaaaagttcctggagaa
ggcctccccctccccaaaacacccgagaaacgtggggacctcattattgagtttgaagtg
atcttccccgaaaggattccccagacatcaagaaccgtacttgagcaggttcttccaata
tag

KEGG   Homo sapiens (human): 54788
Entry
54788             CDS       T01001                                 

Symbol
DNAJB12, DJ10
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member B12
  KO
K09518  DnaJ homolog subfamily B member 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54788 (DNAJB12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    54788 (DNAJB12)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   54788 (DNAJB12)
SSDB
Motif
Pfam: DnaJ DUF1977 TPR_2 TPR_1 TPR_19 TPR_14
Other DBs
NCBI-GeneID: 54788
NCBI-ProteinID: NP_001002762
OMIM: 608376
HGNC: 14891
Ensembl: ENSG00000148719
Vega: OTTHUMG00000018436
Pharos: Q9NXW2(Tdark)
UniProt: Q9NXW2 J3KPS0
Structure
PDB: 
2CTP

Position
10q22.1
AA seq 375 aa
MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQ
PPPTDTTHATHRKAGGTDAPSANGEAGGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRG
ASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQA
ARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQG
DGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDT
FSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGT
PSCSRLSEVQASLHG
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaatccaacaaggatgaagctgagcgctgtatcagcatcgccctcaaggccatccag
agcaaccagcccgaccgggcgctccgcttcctggagaaggcacagcggctgtatccgacg
ccgcgagttcgcgccctgattgagtccctcaaccagaaaccacagactgccggtgaccaa
cccccacccacagacacaacccatgccacccacaggaaagcaggtgggaccgatgccccc
tcggccaacggtgaagctggaggagagagcaccaaaggctacactgcagaacaggttgca
gctgtgaaaagggtcaagcaatgtaaagattactatgagatcctgggggtgagcagaggg
gcctcggatgaggacctgaagaaggcctaccgcagactggccctcaaattccacccagac
aagaaccacgcacctggtgccactgaagccttcaaagccattggcacagcatatgcggta
ctcagcaacccggagaagaggaagcagtatgaccagttcggcgatgacaagagccaggcg
gcccggcacggccatgggcatggggatttccaccgtggctttgaggccgacatctcccct
gaagacctcttcaacatgttctttggcggcggcttcccttctagtaacgtccacgtctac
agcaacggccgcatgcgctatacctaccagcaaaggcaggaccgcagggacaaccagggt
gatggcgggctaggggtgtttgtgcagctgatgcctatcctcatcctgattctcgtgtca
gctctcagccagctcatggtctccagtccaccctacagtctgagtccaagaccgtccgtg
ggccacatccacaggcgagtcactgaccacctgggtgtcgtctactatgtgggagacact
ttctccgaagagtacacaggctccagcctcaaaacagtcgagcggaatgtggaagatgat
tatatcgccaacctccggaacaactgctggaaggagaagcagcagaaggaaggcttgctg
taccgggcacgctactttggcgacacagatatgtaccacagagcacagaagatgggcacc
cccagctgcagccgactgtcagaggtgcaggcctccctgcatggatag

KEGG   Homo sapiens (human): 80331
Entry
80331             CDS       T01001                                 

Symbol
DNAJC5, CLN4, CLN4B, CSP, DNAJC5A, NCL, mir-941-2, mir-941-3, mir-941-4, mir-941-5
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member C5
  KO
K09525  DnaJ homolog subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00149  Neuronal ceroid lipofuscinosis
H02276  Kufs disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    80331 (DNAJC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    80331 (DNAJC5)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   80331 (DNAJC5)
SSDB
Motif
Pfam: DnaJ Baculo_F EMP70
Other DBs
NCBI-GeneID: 80331
NCBI-ProteinID: NP_079495
OMIM: 611203
HGNC: 16235
Ensembl: ENSG00000101152
Vega: OTTHUMG00000033007
Pharos: Q9H3Z4(Tbio)
UniProt: Q9H3Z4 Q6AHX3
Structure
PDB: 
2N04 2N05

Position
20q13.33
AA seq 198 aa
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEI
NNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCY
CCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATE
TTQLTADSHPSYHTDGFN
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcagaccagagacagcgctcactgtctacctctggggagtcattgtaccacgtcctt
gggttggacaagaacgcaacctcagatgacattaaaaagtcctatcggaagcttgccttg
aaatatcaccccgacaagaaccccgacaacccggaggccgcggacaagtttaaggagatc
aacaacgcgcacgccatcctcacggacgccacaaaaaggaacatctacgacaagtacggc
tcgctgggtctctacgtggccgagcagtttggggaagagaacgtgaacacctacttcgtg
ctgtccagctggtgggccaaggccctgtttgtcttctgcggcctcctcacgtgctgctac
tgctgctgctgtctgtgctgctgcttcaactgctgctgcgggaagtgtaagcccaaggcg
cctgaaggcgaggagacggagttctacgtgtcccccgaggatctggaggcacagctgcag
tctgacgagagggaggccacagacacgccgatcgtcatacagccggcatccgccaccgag
accacccagctcacagccgactcccaccccagctaccacactgacgggttcaactaa

KEGG   Homo sapiens (human): 85479
Entry
85479             CDS       T01001                                 

Symbol
DNAJC5B, CSP-beta
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member C5 beta
  KO
K09525  DnaJ homolog subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    85479 (DNAJC5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    85479 (DNAJC5B)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   85479 (DNAJC5B)
SSDB
Motif
Pfam: DnaJ EMP70
Other DBs
NCBI-GeneID: 85479
NCBI-ProteinID: NP_149096
OMIM: 613945
HGNC: 24138
Ensembl: ENSG00000147570
Vega: OTTHUMG00000164470
Pharos: Q9UF47(Tdark)
UniProt: Q9UF47 A0A024R7Z1
Position
8q13.1
AA seq 199 aa
MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEK
FKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLL
TGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTN
ANEKTQLIKEGSRSYCTDS
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcatgtaacatacctaaccaaagacagcggactctgtcaacaacaggagaagctcta
tacgaaattcttggtctgcataagggagcatcaaatgaagaaattaagaaaacctacaga
aaattggccctgaaacaccatccagacaagaatccagatgatccagctgctactgagaag
tttaaagaaatcaacaacgcccacgcaatacttaccgacatttcaaagagaagcatatac
gacaagtacggatcgctgggactctacgtggccgagcagtttggagacgaaaacgttaac
acctacttcatgctgtcgagctggtgggcaaaggccctgtttgtcatcgttggcctcttg
acgggctgctacttttgctgctgcctgtgctgctgctgcaactgctgctgtggacactgc
cggcccgagtcatcagtgccagaagaggacttctatgtgtccccagaggatctggaggag
cagatcaagtctgacatggaaaaagatgtggactttccagtttttctccagcctacaaat
gcaaatgagaaaacacagctaatcaaagaaggatctcgaagttattgcacagactcttga

DBGET integrated database retrieval system