KEGG   Homo sapiens (human): 10298Help
Entry
10298             CDS       T01001                                 

Gene name
PAK4
Definition
(RefSeq) p21 (RAC1) activated kinase 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04660  T cell receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05170  Human immunodeficiency virus 1 infection
hsa05206  MicroRNAs in cancer
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    10298 (PAK4)
   04012 ErbB signaling pathway
    10298 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10298 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10298 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    10298 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    10298 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    10298 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    10298 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    10298 (PAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10298 (PAK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10298 (PAK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   10298 (PAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal APH Kdo KIND
Motif
Other DBs
NCBI-GeneID: 10298
NCBI-ProteinID: NP_001014831
OMIM: 605451
HGNC: 16059
Ensembl: ENSG00000130669
Vega: OTTHUMG00000182800
Pharos: O96013(Tchem)
UniProt: O96013 A0A024R0J1
Structure
PDB: 

Position
19q13.2
AA seq 591 aa AA seqDB search
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEE
PATTARGGPGKAGSRGRFAGHSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPL
SGPDVGTPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPHDVAPNGPSAGGLAIP
QSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPRSPQREPQRVS
HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRR
ELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV
CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPY
WMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHK
VSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaggaagaagcgggtggagatctccgcgccgtccaacttcgagcaccgc
gtgcacacgggcttcgaccagcacgagcagaagttcacggggctgccccgccagtggcag
agcctgatcgaggagtcggctcgccggcccaagcccctcgtcgaccccgcctgcatcacc
tccatccagcccggggcccccaagaccatcgtgcggggcagcaaaggtgccaaagatggg
gccctcacgctgctgctggacgagtttgagaacatgtcggtgacacgctccaactccctg
cggagagacagcccgccgccgcccgcccgtgcccgccaggaaaatgggatgccagaggag
ccggccaccacggccagagggggcccagggaaggcaggcagccgaggccggttcgccggt
cacagcgaggcgggtggcggcagtggtgacaggcgacgggcggggccagagaagaggccc
aagtcttccagggagggctcagggggtccccaggagtcctcccgggacaaacgccccctc
tccgggcctgatgtcggcaccccccagcctgctggtctggccagtggggcgaaactggca
gctggccggccctttaacacctacccgagggctgacacggaccacccatcccggggtgcc
cagggggagcctcatgacgtggcccctaacgggccatcagcggggggcctggccatcccc
cagtcctcctcctcctcctcccggcctcccacccgagcccgaggtgcccccagccctgga
gtgctgggaccccacgcctcagagccccagctggcccctccagcctgcacccccgccgcc
cctgctgttcctgggccccctggcccccgctcaccacagcgggagccacagcgagtatcc
catgagcagttccgggctgccctgcagctggtggtggacccaggcgacccccgctcctac
ctggacaacttcatcaagattggcgagggctccacgggcatcgtgtgcatcgccaccgtg
cgcagctcgggcaagctggtggccgtcaagaagatggacctgcgcaagcagcagaggcgc
gagctgctcttcaacgaggtggtaatcatgagggactaccagcacgagaatgtggtggag
atgtacaacagctacctggtgggggacgagctctgggtggtcatggagttcctggaagga
ggcgccctcaccgacatcgtcacccacaccaggatgaacgaggagcagatcgcggccgtg
tgccttgcagtgctgcaggccctgtcggtgctccacgcccagggcgtcatccaccgggac
atcaagagcgactcgatcctgctgacccatgatggcagggtgaagctgtcagactttggg
ttctgcgcccaggtgagcaaggaagtgccccgaaggaagtcgctggtcggcacgccctac
tggatggccccagagctcatctcccgccttccctacgggccagaggtagacatctggtcg
ctggggataatggtgattgagatggtggacggagagcccccctacttcaacgagccaccc
ctcaaagccatgaagatgattcgggacaacctgccaccccgactgaagaacctgcacaag
gtgtcgccatccctgaagggcttcctggaccgcctgctggtgcgagaccctgcccagcgg
gccacggcagccgagctgctgaagcacccattcctggccaaggcagggccgcctgccagc
atcgtgcccctcatgcgccagaaccgcaccagatga

DBGET integrated database retrieval system