KEGG   Homo sapiens (human): 10298Help
Entry
10298             CDS       T01001                                 

Gene name
PAK4
Definition
(RefSeq) p21 (RAC1) activated kinase 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04660  T cell receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05170  Human immunodeficiency virus 1 infection
hsa05206  MicroRNAs in cancer
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    10298 (PAK4)
   04012 ErbB signaling pathway
    10298 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10298 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10298 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    10298 (PAK4)
  09158 Development
   04360 Axon guidance
    10298 (PAK4)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    10298 (PAK4)
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    10298 (PAK4)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    10298 (PAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10298 (PAK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10298 (PAK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   10298 (PAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal APH Kdo KIND
Motif
Other DBs
NCBI-GeneID: 10298
NCBI-ProteinID: NP_001014831
OMIM: 605451
HGNC: 16059
Ensembl: ENSG00000130669
Vega: OTTHUMG00000182800
Pharos: O96013(Tchem)
UniProt: O96013 A0A024R0J1
Structure
PDB: 

Position
19q13.2
AA seq 591 aa AA seqDB search
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEE
PATTARGGPGKAGSRGRFAGHSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPL
SGPDVGTPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPHDVAPNGPSAGGLAIP
QSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPRSPQREPQRVS
HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRR
ELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV
CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPY
WMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHK
VSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaggaagaagcgggtggagatctccgcgccgtccaacttcgagcaccgc
gtgcacacgggcttcgaccagcacgagcagaagttcacggggctgccccgccagtggcag
agcctgatcgaggagtcggctcgccggcccaagcccctcgtcgaccccgcctgcatcacc
tccatccagcccggggcccccaagaccatcgtgcggggcagcaaaggtgccaaagatggg
gccctcacgctgctgctggacgagtttgagaacatgtcggtgacacgctccaactccctg
cggagagacagcccgccgccgcccgcccgtgcccgccaggaaaatgggatgccagaggag
ccggccaccacggccagagggggcccagggaaggcaggcagccgaggccggttcgccggt
cacagcgaggcgggtggcggcagtggtgacaggcgacgggcggggccagagaagaggccc
aagtcttccagggagggctcagggggtccccaggagtcctcccgggacaaacgccccctc
tccgggcctgatgtcggcaccccccagcctgctggtctggccagtggggcgaaactggca
gctggccggccctttaacacctacccgagggctgacacggaccacccatcccggggtgcc
cagggggagcctcatgacgtggcccctaacgggccatcagcggggggcctggccatcccc
cagtcctcctcctcctcctcccggcctcccacccgagcccgaggtgcccccagccctgga
gtgctgggaccccacgcctcagagccccagctggcccctccagcctgcacccccgccgcc
cctgctgttcctgggccccctggcccccgctcaccacagcgggagccacagcgagtatcc
catgagcagttccgggctgccctgcagctggtggtggacccaggcgacccccgctcctac
ctggacaacttcatcaagattggcgagggctccacgggcatcgtgtgcatcgccaccgtg
cgcagctcgggcaagctggtggccgtcaagaagatggacctgcgcaagcagcagaggcgc
gagctgctcttcaacgaggtggtaatcatgagggactaccagcacgagaatgtggtggag
atgtacaacagctacctggtgggggacgagctctgggtggtcatggagttcctggaagga
ggcgccctcaccgacatcgtcacccacaccaggatgaacgaggagcagatcgcggccgtg
tgccttgcagtgctgcaggccctgtcggtgctccacgcccagggcgtcatccaccgggac
atcaagagcgactcgatcctgctgacccatgatggcagggtgaagctgtcagactttggg
ttctgcgcccaggtgagcaaggaagtgccccgaaggaagtcgctggtcggcacgccctac
tggatggccccagagctcatctcccgccttccctacgggccagaggtagacatctggtcg
ctggggataatggtgattgagatggtggacggagagcccccctacttcaacgagccaccc
ctcaaagccatgaagatgattcgggacaacctgccaccccgactgaagaacctgcacaag
gtgtcgccatccctgaagggcttcctggaccgcctgctggtgcgagaccctgcccagcgg
gccacggcagccgagctgctgaagcacccattcctggccaaggcagggccgcctgccagc
atcgtgcccctcatgcgccagaaccgcaccagatga

KEGG   Homo sapiens (human): 106821730Help
Entry
106821730         CDS       T01001                                 

Gene name
BUB1B-PAK6, PAK-5, PAK-6, PAK5, PAK6
Definition
(RefSeq) BUB1B-PAK6 readthrough
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04660  T cell receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05170  Human immunodeficiency virus 1 infection
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106821730 (BUB1B-PAK6)
   04012 ErbB signaling pathway
    106821730 (BUB1B-PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106821730 (BUB1B-PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106821730 (BUB1B-PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    106821730 (BUB1B-PAK6)
  09158 Development
   04360 Axon guidance
    106821730 (BUB1B-PAK6)
 09160 Human Diseases
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    106821730 (BUB1B-PAK6)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    106821730 (BUB1B-PAK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    106821730 (BUB1B-PAK6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106821730 (BUB1B-PAK6)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106821730 (BUB1B-PAK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 106821730
NCBI-ProteinID: NP_001122100
HGNC: 52276
Ensembl: ENSG00000259288
Vega: OTTHUMG00000172398
UniProt: Q9NQU5 A0A024R9Q4
Structure
PDB: 

Position
15q15.1
AA seq 681 aa AA seqDB search
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSERTDPHGLYLSCNGGTPAGHKQMPWPEPQSPRVLPNGLAAKAQSL
GPAEFQGASQRCLQLGACLQSSPPGASPPTGTNRHGMKAAKHGSEEARPQSCLVGSATGR
PGGEGSPSPKTRESSLKRRLFRSMFLSTAATAPPSSSKPGPPPQSKPNSSFRPPQKDNPP
SLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGQLPGRSSPAGSPRTWHAQIS
TSNLYLPQDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgccctgagatctcagcgccacagaacttccagcac
cgtgtccacacctccttcgaccccaaagaaggcaagtttgtgggcctccccccacaatgg
cagaacatcctggacacactgcggcgccccaagcccgtggtggacccttcgcgaatcaca
cgggtgcagctccagcccatgaagacagtggtgcggggcagcgcgatgcctgtggatggc
tacatctcggggctgctcaacgacatccagaagttgtcagtcatcagctccaacaccctg
cgtggccgcagccccaccagccggcggcgggcacagtccctggggctgctgggggatgag
cactgggccaccgacccagacatgtacctccagagcccccagtctgagcgcactgacccc
cacggcctctacctcagctgcaacgggggcacaccagcaggccacaagcagatgccgtgg
cccgagccacagagcccacgggtcctgcccaatgggctggctgcaaaggcacagtccctg
ggccccgccgagtttcagggtgcctcgcagcgctgtctgcagctgggtgcctgcctgcag
agctccccaccaggagcctcgccccccacgggcaccaataggcatggaatgaaggctgcc
aagcatggctctgaggaggcccggccacagtcctgcctggtgggctcagccacaggcagg
ccaggtggggaaggcagccctagccctaagacccgggagagcagcctgaagcgcaggcta
ttccgaagcatgttcctgtccactgctgccacagcccctccaagcagcagcaagccaggc
cctccaccacagagcaagcccaactcctctttccgaccgccgcagaaagacaacccccca
agcctggtggccaaggcccagtccttgccctcggaccagccggtggggaccttcagccct
ctgaccacttcggataccagcagcccccagaagtccctccgcacagccccggccacaggc
cagcttccaggccggtcttccccagcgggatccccccgcacctggcacgcccagatcagc
accagcaacctgtacctgccccaggaccccacggttgccaagggtgccctggctggtgag
gacacaggtgttgtgacacatgagcagttcaaggctgcgctcaggatggtggtggaccag
ggtgacccccggctgctgctggacagctacgtgaagattggcgagggctccaccggcatc
gtctgcttggcccgggagaagcactcgggccgccaggtggccgtcaagatgatggacctc
aggaagcagcagcgcagggagctgctcttcaacgaggtggtgatcatgcgggactaccag
cacttcaacgtggtggagatgtacaagagctacctggtgggcgaggagctgtgggtgctc
atggagttcctgcagggaggagccctcacagacatcgtctcccaagtcaggctgaatgag
gagcagattgccactgtgtgtgaggctgtgctgcaggccctggcctacctgcatgctcag
ggtgtcatccaccgggacatcaagagtgactccatcctgctgaccctcgatggcagggtg
aagctctcggacttcggattctgtgctcagatcagcaaagacgtccctaagaggaagtcc
ctggtgggaaccccctactggatggctcctgaagtgatctccaggtctttgtatgccact
gaggtggatatctggtctctgggcatcatggtgattgagatggtagatggggagccaccg
tacttcagtgactccccagtgcaagccatgaagaggctccgggacagccccccacccaag
ctgaaaaactctcacaaggtctccccagtgctgcgagacttcctggagcggatgctggtg
cgggacccccaagagagagccacagcccaggagctcctagaccaccccttcctgctgcag
acagggctacctgagtgcctggtgcccctgatccagctctaccgaaagcagacctccacc
tgctga

KEGG   Homo sapiens (human): 5058Help
Entry
5058              CDS       T01001                                 

Gene name
PAK1, IDDMSSD, PAKalpha
Definition
(RefSeq) p21 (RAC1) activated kinase 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04360  Axon guidance
hsa04392  Hippo signaling pathway - multiple species
hsa04510  Focal adhesion
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05211  Renal cell carcinoma
Network
N00433  CXCR4-GNB/G-RAC signaling pathway
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5058 (PAK1)
   04010 MAPK signaling pathway
    5058 (PAK1)
   04012 ErbB signaling pathway
    5058 (PAK1)
   04392 Hippo signaling pathway - multiple species
    5058 (PAK1)
   04024 cAMP signaling pathway
    5058 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5058 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5058 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    5058 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    5058 (PAK1)
   04660 T cell receptor signaling pathway
    5058 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    5058 (PAK1)
   04062 Chemokine signaling pathway
    5058 (PAK1)
  09158 Development
   04360 Axon guidance
    5058 (PAK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    5058 (PAK1)
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    5058 (PAK1)
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5058 (PAK1)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5058 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5058 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5058 (PAK1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5058 (PAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5058 (PAK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   5058 (PAK1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    5058 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    5058 (PAK1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     5058 (PAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Motif
Other DBs
NCBI-GeneID: 5058
NCBI-ProteinID: NP_002567
OMIM: 602590
HGNC: 8590
Ensembl: ENSG00000149269
Vega: OTTHUMG00000165138
Pharos: Q13153(Tchem)
UniProt: Q13153 A0A024R5P0
Structure
PDB: 

Position
11q13.5-q14.1
AA seq 545 aa AA seqDB search
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacccccagcccctccgatgagaaatacc
agcactatgattggagccggcagcaaagatgctggaaccctaaaccatggttctaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccattttacct
ggagataaaacaaataaaaagaaagagaaagagcggccagagatttctctcccttcagat
tttgaacacacaattcatgtcggttttgatgctgtcacaggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatatcactaagtcggagcagaagaaaaac
ccgcaggctgttctggatgtgttggagttttacaactcgaagaagacatccaacagccag
aaatacatgagctttacagataagtcagctgaggattacaattcttctaatgccttgaat
gtgaaggctgtgtctgagactcctgcagtgccaccagtttcagaagatgaggatgatgat
gatgatgatgctaccccaccaccagtgattgctccacgcccagagcacacaaaatctgta
tacacacggtctgtgattgaaccacttcctgtcactccaactcgggacgtggctacatct
cccatttcacctactgaaaataacaccactccaccagatgctttgacccggaatactgag
aagcagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagcata
gtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggtgct
tcaggcaccgtgtacacagcaatggatgtggccacaggacaggaggtggccattaagcag
atgaatcttcagcagcagcccaagaaagagctgattattaatgagatcctggtcatgagg
gaaaacaagaacccaaacattgtgaattacttggacagttacctcgtgggagatgagctg
tgggttgttatggaatacttggctggaggctccttgacagatgtggtgacagaaacttgc
atggatgaaggccaaattgcagctgtgtgccgtgagtgtctgcaggctctggagttcttg
cattcgaaccaggtcattcacagagacatcaagagtgacaatattctgttgggaatggat
ggctctgtcaagctaactgactttggattctgtgcacagataaccccagagcagagcaaa
cggagcaccatggtaggaaccccatactggatggcaccagaggttgtgacacgaaaggcc
tatgggcccaaggttgacatctggtccctgggcatcatggccatcgaaatgattgaaggg
gagcctccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaatggg
accccagaacttcagaacccagagaagctgtcagctatcttccgggactttctgaaccgc
tgtctcgagatggatgtggagaagagaggttcagctaaagagctgctacagcatcaattc
ctgaagattgccaagcccctctccagcctcactccactgattgctgcagctaaggaggca
acaaagaacaatcactaa

KEGG   Homo sapiens (human): 5062Help
Entry
5062              CDS       T01001                                 

Gene name
PAK2, PAK65, PAKgamma
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04660  T cell receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05170  Human immunodeficiency virus 1 infection
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5062 (PAK2)
   04010 MAPK signaling pathway
    5062 (PAK2)
   04012 ErbB signaling pathway
    5062 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5062 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5062 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5062 (PAK2)
  09158 Development
   04360 Axon guidance
    5062 (PAK2)
 09160 Human Diseases
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    5062 (PAK2)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5062 (PAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5062 (PAK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5062 (PAK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   5062 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal APH Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 5062
NCBI-ProteinID: NP_002568
OMIM: 605022
HGNC: 8591
Ensembl: ENSG00000180370
Vega: OTTHUMG00000155534
Pharos: Q13177(Tchem)
UniProt: Q13177 A8K5M4
Position
3q29
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagataagcctccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccctctgttccagaagagaaaaagcccaggcataaaatcatctccatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gagcacaccatccatgttggctttgatgctgttactggagaattcactggcatgccagaa
cagtgggctcgattactacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctaaagttctacgactccaacacagtgaagcagaaatatctg
agctttactcctcctgagaaagatggctttccttctggaacaccagcactgaatgccaag
ggaacagaagcacccgcagtagtgacagaggaggaggatgatgatgaagagactgctcct
cccgttattgccccgcgaccggatcatacgaaatcaatttacacacggtctgtaattgac
cctgttcctgcaccagttggtgattcacatgttgatggtgctgccaagtctttagacaaa
cagaaaaagaagactaagatgacagatgaagagattatggagaaattaagaactatcgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggcttct
ggtacagttttcactgctactgacgttgcactgggacaggaggttgctatcaaacaaatt
aatttacagaaacagccaaagaaggaactgatcattaacgagattctggtgatgaaagaa
ttgaaaaatcccaacatcgttaactttttggacagttacctggtaggagatgaattgttt
gtggtcatggaataccttgctggggggtcactcactgatgtggtaacagaaacgtgcatg
gatgaagcacagattgctgctgtatgcagagagtgtttacaggcattggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtacttttgggaatggaagga
tctgttaagctcactgactttggtttctgtgcccagatcacccctgagcagagcaaacgc
agtaccatggtcggaacgccatactggatggcaccagaggtggttacacggaaagcttat
ggccctaaagtcgacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatggaacc
ccagaacttcagaatccagagaaactttccccaatatttcgggatttcttaaatcgatgt
ttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcctttcctg
aaactggccaaaccgttatctagcttgacaccactgatcatggcagctaaagaagcaatg
aagagtaaccgttaa

KEGG   Homo sapiens (human): 5063Help
Entry
5063              CDS       T01001                                 

Gene name
PAK3, ARA, MRX30, MRX47, OPHN3, PAK-3, PAK3beta, bPAK, beta-PAK
Definition
(RefSeq) p21 (RAC1) activated kinase 3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04660  T cell receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05170  Human immunodeficiency virus 1 infection
hsa05211  Renal cell carcinoma
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5063 (PAK3)
   04012 ErbB signaling pathway
    5063 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5063 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5063 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5063 (PAK3)
  09158 Development
   04360 Axon guidance
    5063 (PAK3)
 09160 Human Diseases
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    5063 (PAK3)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    5063 (PAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5063 (PAK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5063 (PAK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   5063 (PAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal Spt5_N APH DSHCT Kdo Ribosomal_60s
Motif
Other DBs
NCBI-GeneID: 5063
NCBI-ProteinID: NP_001121645
OMIM: 300142
HGNC: 8592
Ensembl: ENSG00000077264
Vega: OTTHUMG00000022202
Pharos: O75914(Tchem)
UniProt: O75914
Structure
PDB: 

Position
Xq23
AA seq 559 aa AA seqDB search
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTS
NITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPP
LAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSA
ENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
LDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYL
AGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNE
NPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPL
SSLTPLIIAAKEAIKNSSR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaaacccccggctcctccactgaggatgaatagt
aacaaccgggattcttcagcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagagcgcccagagatctctcttccttcagactttgagcatacgatt
catgtggggtttgatgcagtcaccggggaattcactccagatctctatggctcacagatg
tgcccagggaagctcccagagggaattccagagcaatgggcacgattactccaaacttcc
aacataacaaaattggaacagaagaagaacccacaagctgttctagatgttctcaaattc
tatgattccaaagaaacagtcaacaaccagaaatacatgagctttacatcaggagataaa
agtgcacatggatacatagcagcccatccttcgagtacaaaaacagcatctgagcctcca
ttggcccctcctgtgtctgaagaagaagatgaagaggaagaagaagaagaagatgaaaat
gagccaccaccagttatcgcaccaagaccagagcatacaaaatcaatctatactcgttct
gtggttgaatccattgcttcaccagcagtaccaaataaagaggtcacaccaccctctgct
gaaaatgccaattccagtactttgtacaggaacacagatcggcaaagaaaaaaatccaag
atgacagatgaggagatcttagagaagctaagaagcattgtgagtgttggggacccaaag
aaaaaatacacaagatttgaaaaaattggtcaaggggcatcaggtactgtttatacagca
ctagacattgcaacaggacaagaggtggccataaagcagatgaaccttcaacagcaaccc
aagaaggaattaattattaatgaaattctggtcatgagggaaaataagaaccctaatatt
gttaattatttagatagctacttggtgggtgatgaactatgggtagtcatggaatacttg
gctggtggctctctgactgatgtggtcacagagacctgtatggatgaaggacagatagca
gctgtctgcagagagtgcctgcaagctttggatttcctgcactcaaaccaggtgatccat
agagatataaagagtgacaatattcttctcgggatggatggctctgttaaattgactgac
tttgggttctgtgcccagatcactcctgagcaaagtaaacgaagcactatggtgggaacc
ccatattggatggcacctgaggtggtgactcgaaaagcttatggtccgaaagttgatatc
tggtctcttggaattatggcaattgaaatggtggaaggtgaacccccttaccttaatgaa
aatccactcagggcattgtatctgatagccactaatggaactccagagctccagaatcct
gagagactgtcagctgtattccgtgactttttaaatcgctgtcttgagatggatgtggat
aggcgaggatctgccaaggagcttttgcagcatccatttttaaaattagccaagcctctc
tccagcctgactcctctgattatcgctgcaaaggaagcaattaagaacagcagccgctaa

KEGG   Homo sapiens (human): 56924Help
Entry
56924             CDS       T01001                                 

Gene name
PAK6, PAK5
Definition
(RefSeq) p21 (RAC1) activated kinase 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04660  T cell receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05170  Human immunodeficiency virus 1 infection
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    56924 (PAK6)
   04012 ErbB signaling pathway
    56924 (PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    56924 (PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    56924 (PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    56924 (PAK6)
  09158 Development
   04360 Axon guidance
    56924 (PAK6)
 09160 Human Diseases
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    56924 (PAK6)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    56924 (PAK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    56924 (PAK6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56924 (PAK6)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   56924 (PAK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 56924
NCBI-ProteinID: NP_001263646
OMIM: 608110
HGNC: 16061
Ensembl: ENSG00000137843
Vega: OTTHUMG00000129921
Pharos: Q9NQU5(Tchem)
UniProt: Q9NQU5 A0A024R9Q4
Structure
PDB: 

Position
15q15.1
AA seq 681 aa AA seqDB search
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSERTDPHGLYLSCNGGTPAGHKQMPWPEPQSPRVLPNGLAAKAQSL
GPAEFQGASQRCLQLGACLQSSPPGASPPTGTNRHGMKAAKHGSEEARPQSCLVGSATGR
PGGEGSPSPKTRESSLKRRLFRSMFLSTAATAPPSSSKPGPPPQSKPNSSFRPPQKDNPP
SLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGQLPGRSSPAGSPRTWHAQIS
TSNLYLPQDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgccctgagatctcagcgccacagaacttccagcac
cgtgtccacacctccttcgaccccaaagaaggcaagtttgtgggcctccccccacaatgg
cagaacatcctggacacactgcggcgccccaagcccgtggtggacccttcgcgaatcaca
cgggtgcagctccagcccatgaagacagtggtgcggggcagcgcgatgcctgtggatggc
tacatctcggggctgctcaacgacatccagaagttgtcagtcatcagctccaacaccctg
cgtggccgcagccccaccagccggcggcgggcacagtccctggggctgctgggggatgag
cactgggccaccgacccagacatgtacctccagagcccccagtctgagcgcactgacccc
cacggcctctacctcagctgcaacgggggcacaccagcaggccacaagcagatgccgtgg
cccgagccacagagcccacgggtcctgcccaatgggctggctgcaaaggcacagtccctg
ggccccgccgagtttcagggtgcctcgcagcgctgtctgcagctgggtgcctgcctgcag
agctccccaccaggagcctcgccccccacgggcaccaataggcatggaatgaaggctgcc
aagcatggctctgaggaggcccggccacagtcctgcctggtgggctcagccacaggcagg
ccaggtggggaaggcagccctagccctaagacccgggagagcagcctgaagcgcaggcta
ttccgaagcatgttcctgtccactgctgccacagcccctccaagcagcagcaagccaggc
cctccaccacagagcaagcccaactcctctttccgaccgccgcagaaagacaacccccca
agcctggtggccaaggcccagtccttgccctcggaccagccggtggggaccttcagccct
ctgaccacttcggataccagcagcccccagaagtccctccgcacagccccggccacaggc
cagcttccaggccggtcttccccagcgggatccccccgcacctggcacgcccagatcagc
accagcaacctgtacctgccccaggaccccacggttgccaagggtgccctggctggtgag
gacacaggtgttgtgacacatgagcagttcaaggctgcgctcaggatggtggtggaccag
ggtgacccccggctgctgctggacagctacgtgaagattggcgagggctccaccggcatc
gtctgcttggcccgggagaagcactcgggccgccaggtggccgtcaagatgatggacctc
aggaagcagcagcgcagggagctgctcttcaacgaggtggtgatcatgcgggactaccag
cacttcaacgtggtggagatgtacaagagctacctggtgggcgaggagctgtgggtgctc
atggagttcctgcagggaggagccctcacagacatcgtctcccaagtcaggctgaatgag
gagcagattgccactgtgtgtgaggctgtgctgcaggccctggcctacctgcatgctcag
ggtgtcatccaccgggacatcaagagtgactccatcctgctgaccctcgatggcagggtg
aagctctcggacttcggattctgtgctcagatcagcaaagacgtccctaagaggaagtcc
ctggtgggaaccccctactggatggctcctgaagtgatctccaggtctttgtatgccact
gaggtggatatctggtctctgggcatcatggtgattgagatggtagatggggagccaccg
tacttcagtgactccccagtgcaagccatgaagaggctccgggacagccccccacccaag
ctgaaaaactctcacaaggtctccccagtgctgcgagacttcctggagcggatgctggtg
cgggacccccaagagagagccacagcccaggagctcctagaccaccccttcctgctgcag
acagggctacctgagtgcctggtgcccctgatccagctctaccgaaagcagacctccacc
tgctga

KEGG   Homo sapiens (human): 57144Help
Entry
57144             CDS       T01001                                 

Gene name
PAK5, PAK7
Definition
(RefSeq) p21 (RAC1) activated kinase 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04660  T cell receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05170  Human immunodeficiency virus 1 infection
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    57144 (PAK5)
   04012 ErbB signaling pathway
    57144 (PAK5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    57144 (PAK5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    57144 (PAK5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    57144 (PAK5)
  09158 Development
   04360 Axon guidance
    57144 (PAK5)
 09160 Human Diseases
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    57144 (PAK5)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    57144 (PAK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    57144 (PAK5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     57144 (PAK5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   57144 (PAK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 57144
NCBI-ProteinID: NP_065074
OMIM: 608038
HGNC: 15916
Ensembl: ENSG00000101349
Vega: OTTHUMG00000031857
Pharos: Q9P286(Tchem)
UniProt: Q9P286 B0AZM9
Structure
PDB: 

Position
20p12.2
AA seq 719 aa AA seqDB search
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHA
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
YYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagattgaaatatctggcccgtccaactttgaacacagg
gttcatactgggtttgatccacaagagcagaagtttaccggccttccccagcagtggcac
agcctgttagcagatacggccaacaggccaaagcctatggtggacccttcatgcatcaca
cccatccagctggctcctatgaagacaatcgttagaggaaacaaaccctgcaaggaaacc
tccatcaacggcctgctagaggattttgacaacatctcggtgactcgctccaactcccta
aggaaagaaagcccacccaccccagatcagggagcctccagccacggtccaggccacgcg
gaagaaaatggcttcatcaccttctcccagtattccagcgaatccgatactactgctgac
tacacgaccgaaaagtacagggagaagagtctctatggagatgatctggatccgtattat
agaggcagccacgcagccaagcaaaatgggcacgtaatgaaaatgaagcacggggaggcc
tactattctgaggtgaagcctttgaaatccgattttgccagattttctgccgattatcac
tcacatttggactcactgagcaaaccaagtgaatacagtgacctcaagtgggagtatcag
agagcctcgagtagctcccctctggattattcattccaattcacaccttctagaactgca
gggaccagcgggtgctccaaggagagcctggcgtacagtgaaagtgaatggggacccagc
ctggatgactatgacaggaggccaaagtcttcgtacctgaatcagacaagccctcagccc
accatgcggcagaggtccaggtcaggctcgggactccaggaaccgatgatgccatttgga
gcaagtgcatttaaaacccatccccaaggacactcctacaactcctacacctaccctcgc
ttgtccgagcccacaatgtgcattccaaaggtggattacgatcgagcacagatggtcctc
agccctccactgtcagggtctgacacctaccccaggggccctgccaaactacctcaaagt
caaagcaaatcgggctattcctcaagcagtcaccagtacccgtctgggtaccacaaagcc
accttgtaccatcacccctccctgcagagcagttcgcagtacatctccacggcttcctac
ctgagctccctcagcctctcatccagcacctacccgccgcccagctggggctcctcctcc
gaccagcagccctccagggtgtcccatgaacagtttcgggcggccctgcagctggtggtc
agcccaggagaccccagggaatacttggccaactttatcaaaatcggggaaggctcaacc
ggcatcgtatgcatcgccaccgagaaacacacagggaaacaagttgcagtgaagaaaatg
gacctccggaagcaacagagacgagaactgcttttcaatgaggtcgtgatcatgcgggat
taccaccatgacaatgtggttgacatgtacagcagctaccttgtcggcgatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacattgtgactcacaccagaatg
aatgaagaacagatagctactgtctgcctgtcagttctgagagctctctcctaccttcat
aaccaaggagtgattcacagggacataaaaagtgactccatcctcctgacaagcgatggc
cggataaagttgtctgattttggtttctgtgctcaagtttccaaagaggtgccgaagagg
aaatcattggttggcactccctactggatggcccctgaggtgatttctaggctaccttat
gggacagaggtggacatctggtccctcgggatcatggtgatagaaatgattgatggcgag
cccccctacttcaatgagcctcccctccaggcgatgcggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtttcttcagtgctccggggattcctagacttgatg
ttggtgagggagccctctcagagagcaacagcccaggaactcctcggacatccattctta
aaactagcaggtccaccgtcttgcatcgtccccctcatgagacaatacaggcatcactga

DBGET integrated database retrieval system