KEGG   Homo sapiens (human): 10299Help
Entry
10299             CDS       T01001                                 

Gene name
MARCHF6, DOA10, FAME3, MARCH-VI, MARCH6, RNF176, TEB4
Definition
(RefSeq) membrane associated ring-CH-type finger 6
  KO
K10661  E3 ubiquitin-protein ligase MARCH6 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10299 (MARCHF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10299 (MARCHF6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     10299 (MARCHF6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   March proteins
    10299 (MARCHF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RINGv zf-ANAPC11
Motif
Other DBs
NCBI-GeneID: 10299
NCBI-ProteinID: NP_005876
OMIM: 613297
HGNC: 30550
Ensembl: ENSG00000145495
Vega: OTTHUMG00000162027
Pharos: O60337(Tbio)
UniProt: O60337
Position
5p15.2
AA seq 910 aa AA seqDB search
MDTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFA
FTPIYSPDMPSRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFT
GSVSSLLTLPLDMLSTENLLADCLQGCFVVTCTLCAFISLVWLREQIVHGGAPIWLEHAA
PPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQDDQAEEEEEDNEEED
DAGVEDAADANNGAQDDMNWNALEWDRAAEELTWERMLGLDGSLVFLEHVFWVVSLNTLF
ILVFAFCPYHIGHFSLVGLGFEEHVQASHFEGLITTIVGYILLAITLIICHGLATLVKFH
RSRRLLGVCYIVVKVSLLVVVEIGVFPLICGWWLDICSLEMFDATLKDRELSFQSAPGTT
MFLHWLVGMVYVFYFASFILLLREVLRPGVLWFLRNLNDPDFNPVQEMIHLPIYRHLRRF
ILSVIVFGSIVLLMLWLPIRIIKSVLPNFLPYNVMLYSDAPVSELSLELLLLQVVLPALL
EQGHTRQWLKGLVRAWTVTAGYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVV
GEGLHAAHQAILQQGGPVGFQPYRRPLNFPLRIFLLIVFMCITLLIASLICLTLPVFAGR
WLMSFWTGTAKIHELYTAACGLYVCWLTIRAVTVMVAWMPQGRRVIFQKVKEWSLMIMKT
LIVAVLLAGVVPLLLGLLFELVIVAPLRVPLDQTPLFYPWQDWALGVLHAKIIAAITLMG
PQWWLKTVIEQVYANGIRNIDLHYIVRKLAAPVISVLLLSLCVPYVIASGVVPLLGVTAE
MQNLVHRRIYPFLLMVVVLMAILSFQVRQFKRLYEHIKNDKYLVGQRLVNYERKSGKQGS
SPPPPQSSQE
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgcggaggaagacatatgtagagtgtgtcggtcagaaggaacacctgagaaa
ccgctttatcatccttgtgtatgtactggcagtattaagtttatccatcaagaatgctta
gttcaatggctgaaacacagtcgaaaagaatactgtgaattatgcaagcacagatttgct
tttacaccaatttattctccagatatgccttcacggcttccaattcaagacatatttgct
ggactggttacaagtattggcactgcaatacgatattggtttcattatacacttgtggcc
tttgcatggttgggagttgttcctcttacagcatgccgcatctacaagtgcttgtttact
ggctccgtgagctcactactgacgctgccattagatatgctgtcaacggaaaatttgttg
gcagattgtttgcagggttgttttgtggtgacgtgcacactgtgtgcattcatcagcctg
gtgtggttgagagagcagatagtccatgggggagcaccaatttggttggagcatgctgcc
ccaccgttcaatgctgcggggcatcaccaaaatgaggctccagcaggaggaaatggtgca
gaaaatgttgctgctgatcagcctgctaacccaccagctgagaacgcagtggtgggggaa
aaccctgatgcccaggatgaccaggcagaagaggaggaggaggacaatgaggaggaagat
gacgctggtgtggaggatgcggcagatgctaataacggagcccaggatgacatgaattgg
aatgctttagaatgggaccgagctgctgaagagcttacatgggaaagaatgctaggactt
gatggatcactagtttttctggaacatgtcttctgggtggtatctttaaatacactgttc
attcttgtttttgcattttgcccttaccatattggtcatttctcccttgttggtttggga
tttgaagaacacgtccaagcatctcattttgaaggcctaatcacaaccatagttgggtat
atacttttagcaataacactgataatttgtcatggcttggcaactcttgtgaaatttcat
agatctcgtcgcttactgggagtctgctatattgttgttaaggtctctttgttagtggtg
gtagaaattggagtattccctctcatttgtggttggtggctggatatctgttccttggaa
atgtttgatgctactctgaaagatcgagaactgagctttcagtcggctccaggtactacc
atgtttctgcattggctagtgggaatggtatatgtcttctactttgcctccttcattcta
ctactgagagaggtacttcgacctggtgtcctgtggtttctaaggaatttgaatgatcca
gatttcaatccagtacaggaaatgatccatttgccaatatataggcatctccgaagattt
attttgtcagtgattgtctttggctccattgtcctcctgatgctttggcttcctatacgt
ataattaagagtgtgctgcctaattttcttccatacaatgtcatgctctacagtgatgct
ccagtgagtgaactgtccctcgagctgcttctgcttcaggttgtcttgccagcattactc
gaacagggacacacgaggcagtggctgaaggggctggtgcgagcgtggactgtgaccgcc
ggatacttgctggatcttcattcttatttattgggagaccaggaagaaaatgaaaacagt
gcaaatcaacaagttaacaataatcagcatgctcgaaataacaacgctattcctgtggtg
ggagaaggccttcatgcagcccaccaagccatactccagcagggagggcctgttggcttt
cagccttaccgccgacctttaaattttccactcaggatatttctgttgattgtcttcatg
tgtataacattactgattgccagcctcatctgccttactttaccagtatttgctggccgt
tggttaatgtcgttttggacggggactgccaaaatccatgagctctacacagctgcttgt
ggtctctatgtttgctggctaaccataagggctgtgacggtgatggtggcatggatgcct
cagggacgcagagtgatcttccagaaggttaaagagtggtctctcatgatcatgaagact
ttgatagttgcggtgctgttggctggagttgtccctctccttctggggctcctgtttgag
ctggtcattgtggctcccctgagggttcccttggatcagactcctcttttttatccatgg
caggactgggcacttggagtcctgcatgccaaaatcattgcagctataacattgatgggt
cctcagtggtggttgaaaactgtaattgaacaggtttacgcaaatggcatccggaacatt
gaccttcactatattgttcgtaaactggcagctcccgtgatctctgtgctgttgctttcc
ctgtgtgtaccttatgtcatagcttctggtgttgttcctttactaggtgttactgcggaa
atgcaaaacttagtccatcggcggatttatccatttttactgatggtcgtggtattgatg
gcaattttgtccttccaagtccgccagtttaagcgcctttatgaacatattaaaaatgac
aagtaccttgtgggtcaacgactcgtgaactacgaacggaaatctggcaaacaaggctca
tctccaccacctccacagtcatcccaagaataa

DBGET integrated database retrieval system