KEGG   Homo sapiens (human): 10300Help
Entry
10300             CDS       T01001                                 

Gene name
KATNB1, KAT, LIS6
Definition
(RefSeq) katanin regulatory subunit B1
  KO
K18643  katanin p80 WD40 repeat-containing subunit B1
Organism
hsa  Homo sapiens (human)
Disease
H00268  Lissencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10300 (KATNB1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     10300 (KATNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Katanin_con80 WD40 ANAPC4_WD40 eIF2A Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 10300
NCBI-ProteinID: NP_005877
OMIM: 602703
HGNC: 6217
Ensembl: ENSG00000140854
Vega: OTTHUMG00000133467
Pharos: Q9BVA0(Tbio)
UniProt: Q9BVA0
Position
16q21
AA seq 655 aa AA seqDB search
MATPVVTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLT
GHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFV
ASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGK
MMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFN
PDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAICNDQLIGVAFSQSNVSSYVV
DLTRVTRTGTVARDPVQDHRPLAQPLPNPSAPLRRIYERPSTTCSKPQRVKQNSESERRS
PSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPRRSEPFPAPPEDDAATAKEAAKP
SPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQA
ELVDEDAMSQIRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVVVDL
LNIVNQKASLWKLDLCTTVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDMLAAP
PSVGVDISREERLHKCRLCYKQLKSISGLVKSKSGLSGRHGSTFRELHLLMASLD
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggccacccctgtggtcaccaagacagcctggaagttgcaagagatcgtcgcgcatgcc
agcaacgtgtcctcactggtgctgggcaaagcctccgggcggctgctggctacaggcggg
gatgactgccgcgtcaacctgtggtccatcaacaagcccaactgcatcatgagcctgacg
ggccacacatccccagtggagagcgtccgcctcaacacccccgaggagctcatcgtggcc
ggctctcagtcgggctccatccgtgtctgggacctggaagctgccaaaattcttcgcaca
ctcatgggacacaaagccaacatctgcagcctggatttccacccgtacggcgagtttgta
gcctctggttcccaggacacaaacatcaagctctgggacatcaggaggaaaggctgtgtc
ttccgatacagggggcacagccaggccgtgcggtgtctccggttcagccccgatgggaag
tggttggcgtcggccgcagatgaccacaccgtgaagctctgggatctcactgccggcaag
atgatgtctgagttccctggtcacacggggcctgtcaacgtggtcgagtttcaccccaac
gagtacctcctggcctccggcagctctgacaggacaatccgcttctgggacctggagaag
ttccaggtggtgagctgcatcgaaggggagcctgggcccgtcaggagcgtcctcttcaac
ccagacggctgctgcctgtacagcggctgccaggactcactgcgtgtctacggctgggaa
cctgagcggtgctttgatgtggtcctcgtcaactggggcaaggtggccgacctggccatc
tgcaatgaccagttgataggtgtggccttctcccagagcaacgtctcctcctacgtggtg
gatctgacgcgtgtcaccaggactggcacggtggcccgggaccctgtgcaggaccaccgg
cccctggcacagccactgcccaaccccagcgcccccctccggcgcatctatgagcggccc
agcacaacctgcagcaagcctcagagggtgaagcagaactcagagagcgagcgccgcagc
cccagcagcgaggatgaccgggacgagcgcgagtcccgcgcggagatccagaacgccgag
gactacaacgagatcttccagcccaagaacagcatcagtcggacgccaccccggagaagt
gagcccttccctgcacccccagaggacgacgcagccacagcaaaggaggcagcaaagccc
agccctgccatggatgtgcagttcccggtgccaaatctggaggtcctgccccggccccca
gtggttgcttccacacctgcacccaaggctgagcctgccatcatccctgccacccggaac
gagcccatcgggctgaaggcctccgacttcctgcccgccgtgaagatcccccagcaggcc
gagctggtggacgaggatgccatgtcacagatccgcaaaggccacgacaccatgtgtgtg
gtgctcaccagccgccacaagaacctggacactgtgcgggctgtgtggaccatgggcgac
atcaagacgtcggtggactccgctgtggccatcaacgacctgtcggtggtggtggacctc
ctgaacatcgtcaaccagaaagcctccctgtggaagctggacctgtgcaccaccgtcctg
ccacagattgagaagcttctgcagagcaagtatgagagctacgtccagacgggctgcacc
tccctgaagctgatcctgcagcggtttctgcccctcatcacagacatgctggcggcccca
ccctctgtgggtgtggatatcagcagggaggagaggctgcataagtgccggctctgctac
aagcagcttaagagcatcagcggcctggtcaagagcaagtcaggcctgagcggccgccat
ggcagtaccttccgcgagctgcacctgctcatggccagtctggactga

DBGET integrated database retrieval system