KEGG   Homo sapiens (human): 10307
Entry
10307             CDS       T01001                                 
Symbol
APBB3, FE65L2, SRA
Name
(RefSeq) amyloid beta precursor protein binding family B member 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PID WW GHBP PTB
Other DBs
NCBI-GeneID: 10307
NCBI-ProteinID: NP_573419
OMIM: 602711
HGNC: 20708
Ensembl: ENSG00000113108
Pharos: O95704(Tbio)
UniProt: O95704 Q59EH2 Q96DX9
Structure
Position
5:complement(140558268..140564598)
AA seq 486 aa
MLGKDYMLAIILVNCDDDLWGDHSLEVEAGLPPGWRKIHDAAGTYYWHVPSGSTQWQRPT
WELGDAEDPGTGTEGIWGLRPPKGRSFSSLESSLDRSNSLSWYGGESYIQSMEPGAKCFA
VRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSRSQPPDGAWGEGQNMLMILKKDAMS
LVNPLDHSLIHCQPLVHIRVWGVGSSKGRDRDFAFVASDKDSCMLKCHVFCCDVPAKAIA
SALHGLCAQILSERVEVSGDASCCSPDPISPEDLPRQVELLDAVSQAAQKYEALYMGTLP
VTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVR
LVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVASAA
RGKAWGAQARARLRLKRTSSMDSPGGPLPLPLLKGGVGGAGATPRKRGVFSFLDAFRLKP
SLLHMP
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgctgggcaaggattacatgctggccatcattctggtcaactgcgatgatgacttgtgg
ggggaccacagtctggaggtggaggctggcctgcctcctggctggaggaagatccacgat
gctgcaggtacttactactggcatgtacccagcggtagcacccagtggcagcgcccaacc
tgggaactaggagatgcagaggacccaggcacgggaacggaggggatctggggactgcgg
ccccccaaagggagatccttctccagcctggagagttcactggaccggagtaactctctg
tcctggtatggtggggaatcctacatccagagcatggagccaggggctaagtgctttgca
gtccgctctctgggctgggtagaggtacctgaagaggacctggcaccggggaagagcagt
attgcagtcaataactgtatccagcagctggcccagacccgcagccggagccagcctcca
gatggtgcctggggtgagggccagaacatgctgatgatcctgaagaaggatgccatgagc
ctagtgaatcccctggaccacagtctgatccactgccagcctctggtgcacatccgtgtg
tggggcgtggggagctccaagggccgtgacagggacttcgcttttgtggcaagtgacaaa
gatagctgtatgctcaagtgccatgtgttttgctgtgatgtccctgccaaggccattgcc
agtgccctacatgggctttgtgcccagatcttgtcagagcgagtagaggtcagtggtgat
gcctcttgctgctccccagaccccatctctcctgaagacctgccacggcaagtggagctg
ctggatgcggtaagccaagctgctcagaagtacgaggcactgtatatggggacactgcca
gtcaccaaggccatgggcatggatgtgctgaacgaggccattggtaccctcaccgccagg
ggggaccggaatgcctgggtccccaccatgctcagtgtgtctgactctctcatgactgca
caccccattcaggcagaggccagtacagaggaggagccattgtggcagtgccctgtgcgc
cttgtgacatttattggtgttggccgcgacccacacacctttggcctcatcgctgacctg
ggccgtcagagcttccagtgcgcagccttctggtgccagccccatgcagggggactctct
gaagctgtgcaggctgcctgtatggttcagtaccagaagtgtcttgtggcctctgcagct
cgaggcaaggcctggggtgcccaggcccgtgcccgcctgcggctcaagcggaccagctcc
atggattccccaggaggtcccctgcccctccccctgctcaaaggaggggttggcggtgca
ggggcaacccctcgaaagcggggtgtcttctcttttcttgatgccttccggctgaaaccc
tctctgctccatatgccctaa

DBGET integrated database retrieval system