KEGG   Homo sapiens (human): 10309
Entry
10309             CDS       T01001                                 
Symbol
CCNO, CCNU, CILD29, UDG2
Name
(RefSeq) cyclin O
  KO
K10861  uracil-DNA glycosylase 2 [EC:3.2.2.-]
Organism
hsa  Homo sapiens (human)
Disease
H00564  Primary ciliary dyskinesia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    10309 (CCNO)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     10309 (CCNO)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     10309 (CCNO)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 10309
NCBI-ProteinID: NP_066970
OMIM: 607752
HGNC: 18576
Ensembl: ENSG00000152669
Pharos: P22674(Tbio)
UniProt: P22674
Position
5:complement(55231152..55233608)
AA seq 350 aa
MVTPCPTSPSSPAARAGRRDNDQNLRAPVKKSRRPRLRRKQPLHPLNPCPLPGDSGICDL
FESPSSGSDGAESPSAARGGSPLPGPAQPVAQLDLQTFRDYGQSCYAFRKAQESHFHPRE
ALARQPQVTAESRCKLLSWLIPVHRQFGLSFESLCLTVNTLDRFLTTTPVAADCFQLLGV
TSLLIACKQVEVHPPRVKQLLALCCGAFSRQQLCNLECIVLHKLHFTLGAPTISFFLEHF
THARVEAGQAEASEALEAQALARGVAELSLADYAFTSYSPSLLAICCLALADRMLRVSRP
VDLRLGDHPEAALEDCMGKLQLLVAINSTSLTHMLPVQICEKCSLPPSSK
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggtgaccccctgtcccaccagcccctcgagccccgccgcccgagcggggaggcgggac
aacgaccagaaccttcgcgccccggtgaagaagagcaggcgtccgcgcctccggaggaag
cagccgctgcatcccctgaacccgtgcccgctcccgggagactccggcatttgcgacctg
ttcgagtcccccagctccggctcagacggcgcagagagcccctctgcggcgcggggtggt
agccccctgcccggcccggcccagcccgtggcgcagctagatctacagaccttccgcgac
tacggccagagctgctacgccttccgcaaggcgcaggagagccacttccacccgcgggag
gcgctggcacggcagccacaagtgacggcggaatcccgctgtaagctgctcagctggctg
atcccggtgcaccgccaattcggcctctccttcgagtcgctgtgcctgacggtgaacact
ctggaccgcttcctcaccaccacgccggtggctgcagactgcttccagctgcttggggtc
acctccttgctcatcgcttgcaaacaggtggaggtgcacccgccgcgcgtgaagcagctt
ctggccctctgctgcggcgccttctcccggcagcagctctgcaacctcgagtgcatcgtg
ctgcacaagctgcacttcaccctgggtgcgcccaccattagcttcttcctggagcatttc
acgcacgctcgcgtggaggcggggcaggctgaggcctccgaagctctggaagcgcaagcc
ctggcgcggggggtggcagagctgagtctggccgactatgccttcaccagctactcccct
tccctcctggcgatctgctgcctggcgctggcggaccgcatgctgcgggtctcgcggccc
gtggacttgcgactgggagaccacccggaggcggcgctggaggactgtatgggcaagttg
cagctgctggtggccataaacagtacttccttgactcacatgctgcccgttcagatctgc
gagaagtgcagcctgcccccgagctcgaaataa

DBGET integrated database retrieval system