KEGG   Homo sapiens (human): 1031Help
Entry
1031              CDS       T01001                                 

Gene name
CDKN2C, INK4C, p18, p18-INK4C
Definition
(RefSeq) cyclin dependent kinase inhibitor 2C
  KO
K06622  cyclin-dependent kinase inhibitor 2C
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04110  Cell cycle
hsa04934  Cushing syndrome
hsa05166  Human T-cell leukemia virus 1 infection
hsa05202  Transcriptional misregulation in cancer
Network
N00120  MLL-ENL fusion to transcriptional activation
N00290  Mutation-inactivated MEN1 to transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1031 (CDKN2C)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    1031 (CDKN2C)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    1031 (CDKN2C)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    1031 (CDKN2C)
  09176 Drug resistance: Antineoplastic
   01522 Endocrine resistance
    1031 (CDKN2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3 DUF1843
Motif
Other DBs
NCBI-GeneID: 1031
NCBI-ProteinID: NP_001253
OMIM: 603369
HGNC: 1789
Ensembl: ENSG00000123080
Vega: OTTHUMG00000008046
Pharos: P42773(Tbio)
UniProt: P42773 Q6ICV4
Structure
PDB: 

Position
1p32.3
AA seq 168 aa AA seqDB search
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE
FLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa
cttactagtttgttgcaaaataatgtaaacgtcaatgcacaaaatggatttggaaggact
gcgctgcaggttatgaaacttggaaatcccgagattgccaggagactgctacttagaggt
gctaatcccgatttgaaagaccgaactggtttcgctgtcattcatgatgcggccagagca
ggtttcctggacactttacagactttgctggagtttcaagctgatgttaacatcgaggat
aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccgggtggtggag
ttcctggtgaagcacacggccagcaatgtggggcatcggaaccataagggggacaccgcc
tgtgatttggccaggctctatgggaggaatgaggttgttagcctgatgcaggcaaacggg
gctgggggagccacaaatcttcaataa

DBGET integrated database retrieval system