KEGG   Homo sapiens (human): 10312
Entry
10312             CDS       T01001                                 

Gene name
TCIRG1, ATP6N1C, ATP6V0A3, Atp6i, OC-116kDa, OC116, OPTB1, Stv1, TIRC7, Vph1, a3
Definition
(RefSeq) T cell immune regulator 1, ATPase H+ transporting V0 subunit a3
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Disease
H00436  Osteopetrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    10312 (TCIRG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    10312 (TCIRG1)
   04142 Lysosome
    10312 (TCIRG1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    10312 (TCIRG1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    10312 (TCIRG1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    10312 (TCIRG1)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    10312 (TCIRG1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    10312 (TCIRG1)
   05152 Tuberculosis
    10312 (TCIRG1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    10312 (TCIRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10312 (TCIRG1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10312 (TCIRG1)
SSDB
Motif
Pfam: V_ATPase_I APG6_N Romo1 DUF2730
Other DBs
NCBI-GeneID: 10312
NCBI-ProteinID: NP_006010
OMIM: 604592
HGNC: 11647
Ensembl: ENSG00000110719
Vega: OTTHUMG00000167358
Pharos: Q13488(Tbio)
UniProt: Q13488 A0A024R5E5
Position
11q13.2
AA seq 830 aa
MGSMFRSEEVALVQLFLPTAAAYTCVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEE
LEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRA
QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAP
ALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFH
CHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMK
AVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRDMPPT
LIRTNRFTASFQGIVDAYGVGRYQEVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALAM
VLAENRPAVKAAQNEIWQTFFRGRYLLLLMGLFSIYTGFIYNECFSRATSIFPSGWSVAA
MANQSGWSDAFLAQHTMLTLDPNVTGVFLGPYPFGIDPIWSLAANHLSFLNSFKMKMSVI
LGVVHMAFGVVLGVFNHVHFGQRHRLLLETLPELTFLLGLFGYLVFLVIYKWLCVWAARA
ASAPSILIHFINMFLFSHSPSNRLLYPRQEVVQATLVVLALAMVPILLLGTPLHLLHRHR
RRLRRRPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHT
IEFCLGCVSNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGLGREVGVAAVVLVPIFAAF
AVMTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFTFAATDD
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgggctccatgttccggagcgaggaggtggccctggtccagctctttctgcccacagcg
gctgcctacacctgcgtgagtcggctgggcgagctgggcctcgtggagttcagagacctc
aacgcctcggtgagcgccttccagagacgctttgtggttgatgttcggcgctgtgaggag
ctggagaagaccttcaccttcctgcaggaggaggtgcggcgggctgggctggtcctgccc
ccgccaaaggggaggctgccggcacccccaccccgggacctgctgcgcatccaggaggag
acggagcgcctggcccaggagctgcgggatgtgcggggcaaccagcaggccctgcgggcc
cagctgcaccagctgcagctccacgccgccgtgctacgccagggccatgaacctcagctg
gcagccgcccacacagatggggcctcagagaggacgcccctgctccaggcccccgggggg
ccgcaccaggacctgagggtcaactttgtggcaggtgccgtggagccccacaaggcccct
gccctagagcgcctgctctggagggcctgccgcggcttcctcattgccagcttcagggag
ctggagcagccgctggagcaccccgtgacgggcgagccagccacgtggatgaccttcctc
atctcctactggggtgagcagatcggacagaagatccgcaagatcacggactgcttccac
tgccacgtcttcccgtttctgcagcaggaggaggcccgcctcggggccctgcagcagctg
caacagcagagccaggagctgcaggaggtcctcggggagacagagcggttcctgagccag
gtgctaggccgggtgctgcagctgctgccgccagggcaggtgcaggtccacaagatgaag
gccgtgtacctggccctgaaccagtgcagcgtgagcaccacgcacaagtgcctcattgcc
gaggcctggtgctctgtgcgagacctgcccgccctgcaggaggccctgcgggacagctcg
atggaggagggagtgagtgccgtggctcaccgcatcccctgccgggacatgccccccaca
ctcatccgcaccaaccgcttcacggccagcttccagggcatcgtggatgcctacggcgtg
ggccgctaccaggaggtcaaccccgctccctacaccatcatcaccttccccttcctgttt
gctgtgatgttcggggatgtgggccacgggctgctcatgttcctgttcgccctggccatg
gtccttgcggagaaccgaccggctgtgaaggccgcgcagaacgagatctggcagactttc
ttcaggggccgctacctgctcctgcttatgggcctgttctccatctacaccggcttcatc
tacaacgagtgcttcagtcgcgccaccagcatcttcccctcgggctggagtgtggccgcc
atggccaaccagtctggctggagtgatgcattcctggcccagcacacgatgcttaccctg
gatcccaacgtcaccggtgtcttcctgggaccctacccctttggcatcgatcctatttgg
agcctggctgccaaccacttgagcttcctcaactccttcaagatgaagatgtccgtcatc
ctgggcgtcgtgcacatggcctttggggtggtcctcggagtcttcaaccacgtgcacttt
ggccagaggcaccggctgctgctggagacgctgccggagctcaccttcctgctgggactc
ttcggttacctcgtgttcctagtcatctacaagtggctgtgtgtctgggctgccagggcc
gcctcggcccccagcatcctcatccacttcatcaacatgttcctcttctcccacagcccc
agcaacaggctgctctacccccggcaggaggtggtccaggccacgctggtggtcctggcc
ttggccatggtgcccatcctgctgcttggcacacccctgcacctgctgcaccgccaccgc
cgccgcctgcggaggaggcccgctgaccgacaggaggaaaacaaggccgggttgctggac
ctgcctgacgcatctgtgaatggctggagctccgatgaggaaaaggcagggggcctggat
gatgaagaggaggccgagctcgtcccctccgaggtgctcatgcaccaggccatccacacc
atcgagttctgcctgggctgcgtctccaacaccgcctcctacctgcgcctgtgggccctg
agcctggcccacgcccagctgtccgaggttctgtgggccatggtgatgcgcataggcctg
ggcctgggccgggaggtgggcgtggcggctgtggtgctggtccccatctttgccgccttt
gccgtgatgaccgtggctatcctgctggtgatggagggactctcagccttcctgcacgcc
ctgcggctgcactgggtggaattccagaacaagttctactcaggcacgggctacaagctg
agtcccttcaccttcgctgccacagatgactag

KEGG   Homo sapiens (human): 23545
Entry
23545             CDS       T01001                                 

Gene name
ATP6V0A2, A2, ARCL, ARCL2A, ATP6A2, ATP6N1D, J6B7, RTF, STV1, TJ6, TJ6M, TJ6S, VPH1, WSS
Definition
(RefSeq) ATPase H+ transporting V0 subunit a2
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Disease
H00557  Cutis laxa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    23545 (ATP6V0A2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    23545 (ATP6V0A2)
   04142 Lysosome
    23545 (ATP6V0A2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    23545 (ATP6V0A2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    23545 (ATP6V0A2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    23545 (ATP6V0A2)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    23545 (ATP6V0A2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    23545 (ATP6V0A2)
   05152 Tuberculosis
    23545 (ATP6V0A2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    23545 (ATP6V0A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23545 (ATP6V0A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   23545 (ATP6V0A2)
SSDB
Motif
Pfam: V_ATPase_I Takusan CENP-F_leu_zip
Other DBs
NCBI-GeneID: 23545
NCBI-ProteinID: NP_036595
OMIM: 611716
HGNC: 18481
Ensembl: ENSG00000185344
Vega: OTTHUMG00000168723
Pharos: Q9Y487(Tbio)
UniProt: Q9Y487
Position
12q24.31
AA seq 856 aa
MGSLFRSETMCLAQLFLQSGTAYECLSALGEKGLVQFRDLNQNVSSFQRKFVGEVKRCEE
LERILVYLVQEINRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRK
NLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPSLESDSLLDYSCMQRLGAKLGFVSGLI
NQGKVEAFEKMLWRVCKGYTIVSYAELDESLEDPETGEVIKWYVFLISFWGEQIGHKVKK
ICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSRVI
QVKKMKAIYHMLNMCSFDVTNKCLIAEVWCPEADLQDLRRALEEGSRESGATIPSFMNII
PTKETPPTRIRTNKFTEGFQNIVDAYGVGSYREVNPALFTIITFPFLFAVMFGDFGHGFV
MFLFALLLVLNENHPRLNQSQEIMRMFFNGRYILLLMGLFSVYTGLIYNDCFSKSVNLFG
SGWNVSAMYSSSHPPAEHKKMVLWNDSVVRHNSILQLDPSIPGVFRGPYPLGIDPIWNLA
TNRLTFLNSFKMKMSVILGIIHMTFGVILGIFNHLHFRKKFNIYLVSIPELLFMLCIFGY
LIFMIFYKWLVFSAETSRVAPSILIEFINMFLFPASKTSGLYTGQEYVQRVLLVVTALSV
PVLFLGKPLFLLWLHNGRSCFGVNRSGYTLIRKDSEEEVSLLGSQDIEEGNHQVEDGCRE
MACEEFNFGEILMTQVIHSIEYCLGCISNTASYLRLWALSLAHAQLSDVLWAMLMRVGLR
VDTTYGVLLLLPVIALFAVLTIFILLIMEGLSAFLHAIRLHWVEFQNKFYVGAGTKFVPF
SFSLLSSKFNNDDSVA
NT seq 2571 nt   +upstreamnt  +downstreamnt
atggggtccctgttccggagcgagaccatgtgcctggcgcagctcttcctgcagtcgggc
acggcctacgagtgcctcagcgccctgggcgagaaaggcctggtccagttccgagacctc
aaccagaacgtaagttctttccaaagaaaatttgttggtgaggtgaagaggtgtgaagag
ctagagcgaatattggtgtatttggtacaggaaattaatagagctgatattccccttcct
gaaggagaggccagccctcctgcgccacccctgaaacaggttctagaaatgcaggagcag
ttgcagaagctcgaggttgaactgagagaagtcactaagaacaaggagaaactgaggaaa
aacttgctggaactgatagagtacactcacatgctgagagtgacaaagacctttgtgaaa
cgcaatgttgagtttgaacccacttatgaagaattcccttccttagagagtgattctttg
ttggattacagctgtatgcagaggctgggagcaaaactgggatttgtgtctggcctaatt
aaccaaggaaaagtggaagcatttgaaaaaatgttgtggagagtctgcaaagggtacacc
atcgtgtcctatgcagaactggatgaatcccttgaagaccctgaaacaggggaagtcata
aaatggtatgtctttttaatatccttttggggagagcagattggccacaaggttaagaag
atatgtgattgctaccactgccacgtgtacccctatccaaacacagccgaggagcggagg
gagatccaggaggggctgaacacccgcatccaggatctctacactgtactgcacaaaacc
gaggactatttgaggcaagtgctatgtaaagccgccgagtctgtctacagccgtgtgatc
caggtgaagaaaatgaaggccatctatcacatgctgaacatgtgcagctttgacgtgacc
aacaagtgcctcattgctgaggtctggtgtcccgaggcggatctgcaggacctgcgccgg
gcactggaggagggctcgagagagagtggtgctacaatcccctcattcatgaatataatc
cccacaaaagaaacaccccccactcggatccgcaccaacaaattcaccgagggatttcag
aacatcgtggatgcttatggagtcggaagctacagagaagtcaatccagctctctttacc
atcatcaccttcccgtttttatttgctgtgatgtttggagacttcggacatggctttgtg
atgtttttatttgccctcttgttggtgttaaatgaaaatcatcccagactaaatcagtca
caagagatcatgaggatgttttttaatggccggtacatcctcctgctgatggggctgttc
tcagtgtacactggcctcatctacaacgactgcttttcaaagtcagtcaacctgttcggc
tctgggtggaacgtgtcggccatgtacagctccagccacccacccgcagagcataagaag
atggtgctttggaatgacagcgtcgttagacacaacagcattttgcagctggatccaagc
attcctggagtgttccgaggcccttatccccttggcattgatcctatttggaacttggcc
acaaatcgcctcacttttctaaactctttcaaaatgaaaatgtccgtgattttaggaatc
attcatatgacttttggagtcattctgggaatatttaaccacttgcacttcaggaagaag
ttcaacatttacctggtttccatcccggaacttctcttcatgctctgtatctttggatac
cttatatttatgattttctacaagtggctggttttttcagcagaaacctccagagttgct
cccagcattctgattgaatttattaacatgtttttattcccagccagtaaaacaagtggc
ctttacacagggcaggagtatgtccagagagtgctgctggttgtcacagcattgtctgtc
cctgtcctcttcttgggaaagccactgtttttgttgtggcttcacaatgggcgtagttgc
ttcggggtgaaccggagtggctacacacttataaggaaagatagtgaggaagaagtttca
ttgctgggaagccaagatatagaagagggaaatcaccaggtggaagatggatgtagagaa
atggcgtgtgaagagtttaattttggagaaatattaatgacccaagtaatccattccatc
gagtactgtctgggatgcatctccaacaccgcctcctacctgaggctctgggcgcttagc
ctggctcacgcacagttgtctgatgtcctgtgggccatgctgatgcgcgtgggcctccgc
gttgacaccacctatggcgtcttgctactgctcccggttatcgcgctctttgcagttttg
accattttcatccttctgatcatggaagggctttctgcgtttcttcacgccatacgcctc
cactgggtagaatttcagaacaaattctacgttggtgcaggcaccaaatttgttcctttc
tcattcagtctactttcatcaaagttcaataacgacgacagtgtggcatga

KEGG   Homo sapiens (human): 245972
Entry
245972            CDS       T01001                                 

Gene name
ATP6V0D2, ATP6D2, VMA6
Definition
(RefSeq) ATPase H+ transporting V0 subunit d2
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    245972 (ATP6V0D2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    245972 (ATP6V0D2)
   04142 Lysosome
    245972 (ATP6V0D2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    245972 (ATP6V0D2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    245972 (ATP6V0D2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    245972 (ATP6V0D2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    245972 (ATP6V0D2)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    245972 (ATP6V0D2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    245972 (ATP6V0D2)
   05152 Tuberculosis
    245972 (ATP6V0D2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    245972 (ATP6V0D2)
SSDB
Motif
Pfam: vATP-synt_AC39
Other DBs
NCBI-GeneID: 245972
NCBI-ProteinID: NP_689778
OMIM: 618072
HGNC: 18266
Ensembl: ENSG00000147614
Vega: OTTHUMG00000163637
Pharos: Q8N8Y2(Tbio)
UniProt: Q8N8Y2 A0A024R991
Position
8q21.3
AA seq 350 aa
MLEGAELYFNVDHGYLEGLVRGCKASLLTQQDYINLVQCETLEDLKIHLQTTDYGNFLAN
HTNPLTVSKIDTEMRKRLCGEFEYFRNHSLEPLSTFLTYMTCSYMIDNVILLMNGALQKK
SVKEILGKCHPLGRFTEMEAVNIAETPSDLFNAILIETPLAPFFQDCMSENALDELNIEL
LRNKLYKSYLEAFYKFCKNHGDVTAEVMCPILEFEADRRAFIITLNSFGTELSKEDRETL
YPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
NVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPIL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgctcgaaggtgcggagctgtacttcaacgtggaccatggctacctggagggcctggtt
cgaggatgcaaggccagcctcctgacccagcaagactatatcaacctggtccagtgtgag
accctagaagacctgaaaattcatctccagactactgattatggtaactttttggctaat
cacacaaatcctcttactgtttccaaaattgacactgagatgaggaaaagactatgtgga
gaatttgagtatttccggaatcattccctggagcccctcagcacatttctcacctatatg
acgtgcagttatatgatagacaatgtgattctgctgatgaatggtgcattgcagaaaaaa
tctgtgaaagaaattctggggaagtgccaccccttgggccgtttcacagaaatggaagct
gtcaacattgcagagacaccttcagatctctttaatgccattctgatcgaaacgccatta
gctccattcttccaagactgcatgtctgaaaatgctctagatgaactgaatattgaattg
ctacgcaataaactatacaagtcttaccttgaggcattctataaattctgtaagaatcat
ggtgatgtcacagcagaagttatgtgtcccattcttgagtttgaggccgacagacgtgct
tttatcatcactcttaactcctttggcactgaattgagcaaagaagaccgagagaccctc
tatccaaccttcggcaaactctatcctgaggggttgcggctgttggctcaagcagaagac
tttgaccagatgaagaacgtagcggatcattacggagtatacaaacctttatttgaagct
gtaggtggcagtgggggaaagacattggaggacgtgttttacgagcgtgaggtacaaatg
aatgtgctggcattcaacagacagttccactacggtgtgttttatgcatatgtaaagctg
aaggaacaggaaattagaaatattgtgtggatagcagaatgtatttcacagaggcatcga
actaaaatcaacagttacattccaattttataa

KEGG   Homo sapiens (human): 50617
Entry
50617             CDS       T01001                                 

Gene name
ATP6V0A4, A4, ATP6N1B, ATP6N2, DRTA3, RDRTA2, RTA1C, RTADR, STV1, VPH1, VPP2
Definition
(RefSeq) ATPase H+ transporting V0 subunit a4
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Disease
H00428  Distal renal tubular acidosis (RTA type 1)
H02310  Renal tubular acidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    50617 (ATP6V0A4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    50617 (ATP6V0A4)
   04142 Lysosome
    50617 (ATP6V0A4)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    50617 (ATP6V0A4)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    50617 (ATP6V0A4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    50617 (ATP6V0A4)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    50617 (ATP6V0A4)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    50617 (ATP6V0A4)
   05152 Tuberculosis
    50617 (ATP6V0A4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    50617 (ATP6V0A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    50617 (ATP6V0A4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   50617 (ATP6V0A4)
SSDB
Motif
Pfam: V_ATPase_I Bacillus_HBL
Other DBs
NCBI-GeneID: 50617
NCBI-ProteinID: NP_065683
OMIM: 605239
HGNC: 866
Ensembl: ENSG00000105929
Vega: OTTHUMG00000157122
Pharos: Q9HBG4(Tbio)
UniProt: Q9HBG4 A0A024R791
Position
7q34
AA seq 840 aa
MVSVFRSEEMCLSQLFLQVEAAYCCVAELGELGLVQFKDLNMNVNSFQRKFVNEVRRCES
LERILRFLEDEMQNEIVVQLLEKSPLTPLPREMITLETVLEKLEGELQEANQNQQALKQS
FLELTELKYLLKKTQDFFETETNLADDFFTEDTSGLLELKAVPAYMTGKLGFIAGVINRE
RMASFERLLWRICRGNVYLKFSEMDAPLEDPVTKEEIQKNIFIIFYQGEQLRQKIKKICD
GFRATVYPCPEPAVERREMLESVNVRLEDLITVITQTESHRQRLLQEAAANWHSWLIKVQ
KMKAVYHILNMCNIDVTQQCVIAEIWFPVADATRIKRALEQGMELSGSSMAPIMTTVQSK
TAPPTFNRTNKFTAGFQNIVDAYGVGSYREINPAPYTIITFPFLFAVMFGDCGHGTVMLL
AALWMILNERRLLSQKTDNEIWNTFFHGRYLILLMGIFSIYTGLIYNDCFSKSLNIFGSS
WSVQPMFRNGTWNTHVMEESLYLQLDPAIPGVYFGNPYPFGIDPIWNLASNKLTFLNSYK
MKMSVILGIVQMVFGVILSLFNHIYFRRTLNIILQFIPEMIFILCLFGYLVFMIIFKWCC
FDVHVSQHAPSILIHFINMFLFNYSDSSNAPLYKHQQEVQSFFVVMALISVPWMLLIKPF
ILRASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVF
VHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMNSGLQTRGWGGIVGVFI
IFAVFAVLTVAILLIMEGLSAFLHALRLHWVEFQNKFYVGDGYKFSPFSFKHILDGTAEE
NT seq 2523 nt   +upstreamnt  +downstreamnt
atggtgtctgtgtttcgaagcgaggagatgtgtttgtcacaactgtttctccaggtggaa
gctgcatattgctgtgtggctgagctcggagagctcggattggttcagttcaaagattta
aatatgaatgtgaacagctttcaaaggaaatttgtgaatgaagtcagaaggtgtgaatca
ctggagagaatcctccgttttctggaagacgagatgcaaaatgagattgtagttcagttg
ctcgagaaaagcccactgaccccgctcccacgggaaatgattaccctggagactgttcta
gaaaaactggaaggagagttacaggaagccaaccagaaccagcaggccttgaaacaaagc
ttcctagaactgacagaactgaaatacctcctgaagaaaacccaagacttctttgagacg
gaaaccaatttagctgatgatttctttactgaggacacttctggcctcctggagttgaaa
gcagtgcctgcatatatgaccggaaagttggggttcatagccggtgtgatcaacagggag
aggatggcttcctttgagcggttactgtggcgaatctgccgaggaaacgtgtacttgaag
ttcagtgagatggacgcccctctggaggatcctgtgacgaaagaagaaattcagaagaac
atattcatcatattttaccaaggagagcagctcaggcagaaaatcaagaagatctgtgat
gggtttcgagccactgtctacccttgcccagagcctgcggtggagcgcagagagatgttg
gagagcgtcaatgtgaggctggaagatttaatcaccgtcataacacaaacagagtctcac
cgccagcgcctgctgcaggaagccgctgccaactggcactcctggctcatcaaggtgcag
aagatgaaagctgtctaccacatcctgaacatgtgcaacatcgacgtcacccagcagtgt
gtcatcgccgagatctggttcccggtggcagatgccacacgtatcaagagggcactggag
caaggcatggaactaagtggctcctccatggcccccatcatgaccacagtgcaatctaaa
acagcccctcccacatttaacaggaccaataaattcacagctggcttccagaatattgtt
gatgcctatggtgtcggcagctaccgggagataaacccagccccctacaccatcatcact
ttccccttcctgttcgctgtgatgtttggagactgtggtcatggaaccgtgatgctcctg
gctgcactttggatgattctgaatgagagacgcttgctctcccagaagacagacaatgag
atttggaacaccttcttccacgggcgctatctgatcctacttatgggcatcttctccatc
tacacgggtttgatctacaatgactgcttctccaagtccttgaacatctttggctcttct
tggagtgtccaacccatgttcagaaacggcacatggaatactcatgtaatggaggaaagt
ctatatctgcagctggacccagccataccaggagtgtattttggaaatccatacccgttt
gggattgatccgatttggaacttggcttcaaacaaactcacatttctgaactcgtataaa
atgaagatgtcggtgatcctgggaattgtccagatggttttcggtgtcatcctcagcctt
ttcaatcacatatacttcagaagaactctcaacatcattctgcaatttatccctgagatg
atttttatcctgtgtctgtttggatacctggttttcatgatcattttcaaatggtgctgc
tttgacgtccatgtatctcagcacgcccccagcatcctcatccacttcatcaacatgttt
ctgtttaactacagtgactcttccaacgcacccctctacaaacatcagcaagaagtccaa
agtttctttgtggttatggctttgatttctgtgccgtggatgcttctgattaagccgttt
attcttagagccagtcatcggaaatcccagctgcaggcatccaggatccaagaagatgcc
actgagaacattgaaggtgatagctccagcccttctagccgttctggccagaggacttct
gcagatacccacggggctctggacgaccatggagaagagttcaactttggagacgtcttt
gtccaccaagccatccacaccatcgagtactgcctgggctgcatttcaaacacagcctcc
tacctgcggctctgggccctcagcctggctcatgcacaactgtctgaagtgctctggact
atggtgatgaacagcggccttcagacgcgaggctggggaggaatcgtcggggtttttatt
atttttgccgtatttgctgtcctgacagtagccatccttctgatcatggagggcctctct
gctttcctgcacgccctgcgactgcactgggttgagttccagaacaagttctatgtcggg
gatggttacaagttttctccattctcctttaaacacatcctggatggcacagccgaggag
tag

KEGG   Homo sapiens (human): 51606
Entry
51606             CDS       T01001                                 

Gene name
ATP6V1H, CGI-11, MSTP042, NBP1, SFD, SFDalpha, SFDbeta, VMA13
Definition
(RefSeq) ATPase H+ transporting V1 subunit H
  KO
K02144  V-type H+-transporting ATPase subunit H
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04150  mTOR signaling pathway
hsa04721  Synaptic vesicle cycle
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    51606 (ATP6V1H)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    51606 (ATP6V1H)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    51606 (ATP6V1H)
   04142 Lysosome
    51606 (ATP6V1H)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    51606 (ATP6V1H)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    51606 (ATP6V1H)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    51606 (ATP6V1H)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    51606 (ATP6V1H)
   05152 Tuberculosis
    51606 (ATP6V1H)
  09163 Immune disease
   05323 Rheumatoid arthritis
    51606 (ATP6V1H)
SSDB
Motif
Pfam: V-ATPase_H_N V-ATPase_H_C Arm Arm_2 Adaptin_N HEAT DUF2326 MCAfunc UCH
Other DBs
NCBI-GeneID: 51606
NCBI-ProteinID: NP_057025
OMIM: 608861
HGNC: 18303
Ensembl: ENSG00000047249
Vega: OTTHUMG00000164231
Pharos: Q9UI12(Tbio)
UniProt: Q9UI12 A0A024R7U9
Position
8q11.23
AA seq 483 aa
MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPE
EKQEMLQTEGSQCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKN
TAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGS
GVAVETGTVSSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQ
YQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSTERE
TRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELK
SGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH
YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAA
ARS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaccaaaatggatatccgaggtgctgtggatgctgctgtccccaccaatattattgct
gccaaggctgcagaagttcgtgcaaacaaagtcaactggcaatcctatcttcagggacag
atgatttctgctgaagattgtgagtttattcagaggtttgaaatgaaacgaagccctgaa
gagaagcaagagatgcttcaaactgaaggcagccagtgtgctaaaacatttataaatctg
atgactcatatctgcaaagaacagaccgttcagtatatactaactatggtggatgatatg
ctgcaggaaaatcatcagcgtgttagcattttctttgactatgcaagatgtagcaagaac
actgcgtggccctactttctgccaatgttgaatcgccaggatcccttcactgttcatatg
gcagcaagaattattgccaagttagcagcttggggaaaagaactgatggaaggcagtgac
ttaaattactatttcaattggataaaaactcagctgagttcacagaaactgcgtggtagc
ggtgttgctgttgaaacaggaacagtctcttcaagtgatagttcgcagtatgtgcagtgc
gtggccgggtgtttgcagctgatgctccgggtcaatgagtaccgctttgcttgggtggaa
gcagatggggtaaattgcataatgggagtgttgagtaacaagtgtggctttcagctccag
tatcaaatgattttttcaatatggctcctggcattcagtcctcaaatgtgtgaacacctg
cggcgctataatatcattccagttctgtctgatatccttcaggagtctgtcaaagagaaa
gtaacaagaatcattcttgcagcatttcgtaactttttagaaaaatcaactgaaagagaa
actcgccaagaatatgccctggctatgattcagtgcaaagttctgaaacagttggagaac
ttggaacagcagaagtacgatgatgaagatatcagcgaagatatcaaatttcttttggaa
aaacttggagagagtgtccaggaccttagttcatttgatgaatacagttcagaacttaaa
tctggaaggttggaatggagtcctgtgcacaaatctgagaaattttggagagagaatgct
gtgaggttaaatgagaagaattatgaactcttgaaaatcttgacaaaacttttggaagtg
tcagatgatccccaagtcttagctgttgctgctcacgatgttggagaatatgtgcggcat
tatccacgaggcaaacgggtcatcgagcagctcggtgggaagcagctggtcatgaaccac
atgcatcatgaagaccagcaggtccgctataatgctctgctggccgtgcagaagctcatg
gtgcacaactgggaataccttggcaagcagctccagtccgagcagccccagaccgctgcc
gcccgaagctaa

KEGG   Homo sapiens (human): 527
Entry
527               CDS       T01001                                 

Gene name
ATP6V0C, ATP6C, ATP6L, ATPL, VATL, VPPC, Vma3
Definition
(RefSeq) ATPase H+ transporting V0 subunit c
  KO
K02155  V-type H+-transporting ATPase 16kDa proteolipid subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00366  HPV E5 to EGFR-PI3K signaling pathway
N00367  HPV E5 to EGFR-RAS-ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    527 (ATP6V0C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    527 (ATP6V0C)
   04142 Lysosome
    527 (ATP6V0C)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    527 (ATP6V0C)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    527 (ATP6V0C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    527 (ATP6V0C)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    527 (ATP6V0C)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    527 (ATP6V0C)
   05152 Tuberculosis
    527 (ATP6V0C)
  09163 Immune disease
   05323 Rheumatoid arthritis
    527 (ATP6V0C)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 527
NCBI-ProteinID: NP_001185498
OMIM: 108745
HGNC: 855
Ensembl: ENSG00000185883
Vega: OTTHUMG00000128865
Pharos: P27449(Tbio)
UniProt: P27449
Position
16p13.3
AA seq 155 aa
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVV
MAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtccgagtccaagagcggccccgagtatgcttcgtttttcgccgtcatgggcgcctcg
gccgccatggtcttcagcgccctgggcgctgcctatggcacagccaagagcggtaccggc
attgcggccatgtctgtcatgcggccggagcagatcatgaagtccatcatcccagtggtc
atggctggcatcatcgccatctacggcctggtggtggcagtcctcatcgccaactccctg
aatgacgacatcagcctctacaagagcttcctccagctgggcgccggcctgagcgtgggc
ctgagcggcctggcagccggctttgccatcggcatcgtgggggacgctggcgtgcggggc
accgcccagcagccccgactattcgtgggcatgatcctgattctcatcttcgccgaggtg
ctcggcctctacggtctcatcgtcgccctcatcctctccacaaagtag

KEGG   Homo sapiens (human): 533
Entry
533               CDS       T01001                                 

Gene name
ATP6V0B, ATP6F, HATPL, VMA16
Definition
(RefSeq) ATPase H+ transporting V0 subunit b
  KO
K03661  V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    533 (ATP6V0B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    533 (ATP6V0B)
   04142 Lysosome
    533 (ATP6V0B)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    533 (ATP6V0B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    533 (ATP6V0B)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    533 (ATP6V0B)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    533 (ATP6V0B)
   05152 Tuberculosis
    533 (ATP6V0B)
  09163 Immune disease
   05323 Rheumatoid arthritis
    533 (ATP6V0B)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 533
NCBI-ProteinID: NP_004038
OMIM: 603717
HGNC: 861
Ensembl: ENSG00000117410
Vega: OTTHUMG00000008298
Pharos: Q99437(Tbio)
UniProt: Q99437
Position
1p34.1
AA seq 205 aa
MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISL
SVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSA
TDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVE
IFGSAIGLFGVIVAILQTSRVKMGD
NT seq 618 nt   +upstreamnt  +downstreamnt
atgacggggctagcactgctctactccggggtcttcgtggccttctgggcctgcgcgctg
gccgtgggagtctgctacaccatttttgatttgggcttccgctttgatgtggcatggttc
ctgacggagacttcgcccttcatgtggtccaacctgggcattggcctagctatctccctg
tctgtggttggggcagcctggggcatctatattaccggctcctccatcattggtggagga
gtgaaggcccccaggatcaagaccaagaacctggtcagcatcatcttctgtgaggctgtg
gccatctacggcatcatcatggcaattgtcattagcaacatggctgagcctttcagtgcc
acagaccccaaggccatcggccatcggaactaccatgcaggctactccatgtttggggct
ggcctcaccgtaggcctgtctaacctcttctgtggagtctgcgtgggcatcgtgggcagt
ggggctgccctggccgatgctcagaaccccagcctctttgtaaagattctcatcgtggag
atctttggcagcgccattggcctctttggggtcatcgtcgcaattcttcagacctccaga
gtgaagatgggtgactag

KEGG   Homo sapiens (human): 535
Entry
535               CDS       T01001                                 

Gene name
ATP6V0A1, ATP6N1, ATP6N1A, Stv1, VPP1, Vph1, a1
Definition
(RefSeq) ATPase H+ transporting V0 subunit a1
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    535 (ATP6V0A1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    535 (ATP6V0A1)
   04142 Lysosome
    535 (ATP6V0A1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    535 (ATP6V0A1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    535 (ATP6V0A1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    535 (ATP6V0A1)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    535 (ATP6V0A1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    535 (ATP6V0A1)
   05152 Tuberculosis
    535 (ATP6V0A1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    535 (ATP6V0A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    535 (ATP6V0A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   535 (ATP6V0A1)
SSDB
Motif
Pfam: V_ATPase_I
Other DBs
NCBI-GeneID: 535
NCBI-ProteinID: NP_001123493
OMIM: 192130
HGNC: 865
Ensembl: ENSG00000033627
Vega: OTTHUMG00000180238
Pharos: Q93050(Tbio)
UniProt: Q93050 Q53X12
Position
17q21.2
AA seq 837 aa
MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEE
MDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKR
NFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPSEMGRGTPLRLGFVAGVINRERI
PTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGF
RASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKM
KAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT
PPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFA
VWMVLRESRILSQKNENEMFSTVFSGRYIILLMGVFSMYTGLIYNDCFSKSLNIFGSSWS
VRPMFTYNWTEETLRGNPVLQLNPALPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMS
VILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAH
TSENAPSLLIHFINMFLFSYPESGYSMLYSGQKGIQCFLVVVALLCVPWMLLFKPLVLRR
QYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDADEPSEDEVFDFGDTMVHQ
AIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGLVLFFFFT
AFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFEE
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgggggagcttttccggagtgaagaaatgacactggcccagctttttctacagtcagag
gctgcttattgttgtgtcagtgaattaggagaacttggaaaggttcagtttcgtgactta
aatccagatgtgaatgttttccaacggaaatttgtgaatgaagttagaagatgtgaagaa
atggatcgaaagcttcgatttgttgagaaagagataagaaaagctaacattccgattatg
gacaccggtgaaaacccagaggttcccttcccccgggacatgattgacttagaggccaat
tttgagaagattgaaaatgaactgaaggaaatcaacacaaaccaggaagctctgaagaga
aacttcctggaactgaccgaattaaaatttatacttcgcaaaactcagcaattttttgat
gagatggcggatccagacttgttggaagagtcctcatccctcttggagccaagtgagatg
ggaagaggcactcctttaagacttggcttcgtggctggtgtcattaaccgggagcgcatc
cctacttttgagcgcatgctttggcgggtatgccggggaaatgtgttcctgcgacaggct
gaaatcgagaaccccctggaggatcctgtgactggcgactacgtgcacaagtctgtgttt
atcattttcttccaaggcgatcagctgaaaaacagagtcaagaaaatctgtgaagggttc
cgagcctcactctatccctgtcctgagacaccacaggagaggaaggaaatggcttctgga
gtgaataccaggattgatgatctccaaatggttctgaatcaaacggaggatcaccgccag
agggttctgcaggcagctgctaagaacatccgtgtctggttcatcaaagtgcggaagatg
aaggccatctatcacaccctgaacctgtgcaacatagatgtgactcagaaatgcttgatt
gcagaggtctggtgccctgtcaccgaccttgactccatccagtttgcactcagaaggggc
acggaacacagtggttccactgtaccttccattttgaacaggatgcagacaaaccagact
cccccaacctataacaaaaccaacaagtttacctatggctttcagaacatagtagatgct
tatggaattggaacttaccgagagataaatccagctccgtatactattatcacgttccct
tttctatttgctgtgatgtttggagacttcggtcatggcattttaatgaccctttttgct
gtgtggatggtactgagggagagccggatcctttcccagaagaatgagaatgagatgttt
agcactgtgttcagtggtcgatacattattttattgatgggtgtgttctccatgtacact
ggcctcatctacaatgattgcttttccaagtctcttaatatctttgggtcatcctggagt
gtacggccgatgtttacttataattggactgaagagacgcttcgggggaaccctgttcta
cagctgaacccagccctccctggagtgtttggtggaccatacccttttggcattgatcca
atttggaacattgctaccaataaactgacgttcttgaactcctttaagatgaagatgtct
gttatccttggtatcatccatatgctgtttggagtcagcctgagtctgttcaaccatatc
tatttcaagaagcccctgaatatctactttggatttattcctgaaataatcttcatgacc
tctttgtttggctatttggttatccttattttttacaagtggacggcctatgatgctcat
acctctgagaatgcaccaagccttctgatccatttcataaacatgttcctcttttcctac
ccagagtctggttattcaatgttgtattctggacagaaaggaattcagtgtttcctggta
gtggttgcactactgtgtgtaccttggatgctgctgtttaaaccattggtccttcgccgt
cagtatttgaggagaaagcatttgggaactctcaactttggtgggatcagggtgggcaac
ggaccgacagaggaggatgctgagattattcagcatgaccagctctccacccactcagag
gacgcagacgagccttccgaggacgaagtgtttgactttggggacaccatggtccaccag
gccatccacaccatcgagtactgcctgggctgcatctccaacactgcctcctacttgcgg
ctctgggccctcagcctcgctcatgcgcagctgtctgaggtgctttggaccatggtgatc
cacatcggcctgagcgtgaagagcttggcgggaggtttggtgctgttcttcttcttcact
gcctttgccaccctgaccgtggccatcctcctgatcatggagggcctctcggcctttctc
cacgcactgcgcttacactgggttgagttccagaataaattctacagcgggaccggtttc
aagttcttacccttctccttcgagcatattcgggaagggaagtttgaagagtga

KEGG   Homo sapiens (human): 537
Entry
537               CDS       T01001                                 

Gene name
ATP6AP1, 16A, ATP6IP1, ATP6S1, Ac45, CF2, VATPS1, XAP-3, XAP3
Definition
(RefSeq) ATPase H+ transporting accessory protein 1
  KO
K03662  V-type H+-transporting ATPase S1 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    537 (ATP6AP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    537 (ATP6AP1)
   04142 Lysosome
    537 (ATP6AP1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    537 (ATP6AP1)
   05165 Human papillomavirus infection
    537 (ATP6AP1)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    537 (ATP6AP1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    537 (ATP6AP1)
   05152 Tuberculosis
    537 (ATP6AP1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    537 (ATP6AP1)
SSDB
Motif
Pfam: ATP-synt_S1
Other DBs
NCBI-GeneID: 537
NCBI-ProteinID: NP_001174
OMIM: 300197
HGNC: 868
Ensembl: ENSG00000071553
Vega: OTTHUMG00000033291
Pharos: Q15904(Tchem)
UniProt: Q15904 A0A384MQW4
Position
Xq28
AA seq 470 aa
MMAAMATARVRMGPRCAQALWRMPWLPVFLSLAAAAAAAAAEQQVPLVLWSSDRDLWAPA
ADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNL
ENALDLAPSSLVLPAVDWYAVSTLTTYLQEKLGASPLHVDLATLRELKLNASLPALLLIR
LPYTASSGLMAPREVLTGNDEVIGQVLSTLKSEDVPYTAALTAVRPSRVARDVAVVAGGL
GRQLLQKQPVSPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS
FWNDSFARLSLTYERLFGTTVTFKFILANRLYPVSARHWFTMERLEVHSNGSVAYFNASQ
VTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDFQIQAFNVMGEQFSYASDCAS
FFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTISLTQIV
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgatggcggccatggcgacggctcgagtgcggatggggccgcggtgcgcccaggcgctc
tggcgcatgccgtggctgccggtgtttttgtcgttggcggcggcggcggcggcggcagcg
gcggagcagcaggtcccgctggtgctgtggtcgagtgaccgggacttgtgggctcctgcg
gccgacactcatgaaggccacatcaccagcgacttgcagctctctacctacttagatccc
gccctggagctgggtcccaggaatgtgctgctgttcctgcaggacaagctgagcattgag
gatttcacagcatatggcggtgtgtttggaaacaagcaggacagcgccttttctaaccta
gagaatgccctggacctggccccctcctcactggtgcttcctgccgtcgactggtatgca
gtcagcactctgaccacttacctgcaggagaagctcggggccagccccttgcatgtggac
ctggccaccctgcgggagctgaagctcaatgccagcctccctgctctgctgctcattcgc
ctgccctacacagccagctctggtctgatggcacccagggaagtcctcacaggcaacgat
gaggtcatcgggcaggtcctgagcacactcaagtccgaagatgtcccatacacagcggcc
ctcacagcggtccgcccttccagggtggcccgtgatgtagccgtggtggccggagggcta
ggtcgccagctgctacaaaaacagccagtatcacctgtgatccatcctcctgtgagttac
aatgacaccgctccccggatcctgttctgggcccaaaacttctctgtggcgtacaaggac
cagtgggaggacctgactcccctcacctttggggtgcaggaactcaacctgactggctcc
ttctggaatgactcctttgccaggctctcactgacctatgaacgactctttggtaccaca
gtgacattcaagttcattctggccaaccgcctctacccagtgtctgcccggcactggttt
accatggagcgcctcgaagtccacagcaatggctccgtcgcctacttcaatgcttcccag
gtcacagggcccagcatctactccttccactgcgagtatgtcagcagcctgagcaagaag
ggtagtctcctcgtggcccgcacgcagccctctccctggcagatgatgcttcaggacttc
cagatccaggctttcaacgtaatgggggagcagttctcctacgccagcgactgtgccagc
ttcttctcccccggcatctggatggggctgctcacctccctgttcatgctcttcatcttc
acctatggcctgcacatgatcctcagcctcaagaccatggatcgctttgatgaccacaag
ggccccactatttctttgacccagattgtgtga

KEGG   Homo sapiens (human): 9114
Entry
9114              CDS       T01001                                 

Gene name
ATP6V0D1, ATP6D, ATP6DV, P39, VATX, VMA6, VPATPD
Definition
(RefSeq) ATPase H+ transporting V0 subunit d1
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    9114 (ATP6V0D1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    9114 (ATP6V0D1)
   04142 Lysosome
    9114 (ATP6V0D1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    9114 (ATP6V0D1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    9114 (ATP6V0D1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    9114 (ATP6V0D1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    9114 (ATP6V0D1)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    9114 (ATP6V0D1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    9114 (ATP6V0D1)
   05152 Tuberculosis
    9114 (ATP6V0D1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    9114 (ATP6V0D1)
SSDB
Motif
Pfam: vATP-synt_AC39 Nab2p_Zf1
Other DBs
NCBI-GeneID: 9114
NCBI-ProteinID: NP_004682
OMIM: 607028
HGNC: 13724
Ensembl: ENSG00000159720
Vega: OTTHUMG00000137515
Pharos: P61421(Tbio)
UniProt: P61421
Position
16q22.1
AA seq 351 aa
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLAN
EASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQR
SIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEI
IRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKL
FPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVK
LNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtcgttcttcccggagctttactttaacgtggacaatggctacttggagggactggtg
cgcggcctgaaggccggggtgctcagccaggccgactacctcaacctggtgcagtgcgag
acgctagaggacttgaaactgcatctgcagagcactgattatggtaacttcctggccaac
gaggcatcacctctgacggtgtcagtcatcgatgaccggctcaaggagaagatggtggtg
gagttccgccacatgaggaaccatgcctatgagccactcgccagcttcctagacttcatt
acttacagttacatgatcgacaacgtgatcctgctcatcacaggcacgctgcaccagcgc
tccatcgctgagctcgtgcccaagtgccacccactaggcagcttcgagcagatggaggcc
gtgaacattgctcagacacctgctgagctctacaatgccattctggtggacacgcctctt
gcggcttttttccaggactgcatttcagagcaggaccttgacgagatgaacatcgagatc
atccgcaacaccctctacaaggcctacctggagtccttctacaagttctgcaccctactg
ggcgggactacggctgatgccatgtgccccatcctggagtttgaagcagaccgccgcgcc
ttcatcatcaccatcaattctttcggcacagagctgtccaaagaggaccgtgccaagctc
tttccacactgtgggcggctctaccctgagggcctggcgcagctggctcgggctgacgac
tatgaacaggtcaagaacgtggccgattactacccggagtacaagctgctcttcgagggt
gcaggtagcaaccctggagacaagacgctggaggaccgattctttgagcacgaggtaaag
ctgaacaagttggccttcctgaaccagttccactttggtgtcttctatgccttcgtgaag
ctcaaggagcaggagtgtcgcaacatcgtgtggatcgctgaatgtatcgcccagcgccac
cgcgccaaaatcgacaactacatccctatcttctag

DBGET integrated database retrieval system