KEGG   Homo sapiens (human): 10313
Entry
10313             CDS       T01001                                 

Gene name
RTN3, ASYIP, HAP, NSPL2, NSPLII, RTN3-A1
Definition
(RefSeq) reticulon 3
  KO
K20723  reticulon-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10313 (RTN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10313 (RTN3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10313 (RTN3)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    10313 (RTN3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    10313 (RTN3)
SSDB
Motif
Pfam: Reticulon
Other DBs
NCBI-GeneID: 10313
NCBI-ProteinID: NP_001252518
OMIM: 604249
HGNC: 10469
Ensembl: ENSG00000133318
Vega: OTTHUMG00000168056
Pharos: O95197(Tbio)
UniProt: O95197
Position
11q13.1
AA seq 1032 aa
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCADSFVSSSSSQPVS
LFSTSQEGLSSLCSDEPSSEIMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKD
HLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQI
DKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEYSKVEGIYTYSLSPSKVSGDDVIE
KDSPESPFEVIIDKAAFDKEFKDSYKESTDDFGSWSVHTDKESSEDISETNDKLFPLRNK
EAGRYPMSALLSRQFSHTNAALEEVSRCVNDMHNFTNEILTWDLVPQVKQQTDKSSDCIT
KTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKP
VPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDE
MDWQSSALGEITEADSSGESDDTVIEDITADTSFENNKIQAEKPVSIPSAVVKTGEREIK
EIPSCEREEKTSKNFEELVSDSELHQDQPDILGRSPASEAACSKVPDTNVSLEDVSEVAP
EKPITTENPKLPSTVSPNVFNETEFSLNVTTSAYLESLHGKNVKHIDDSSPEDLIAAFTE
TRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNGS
EPLGVFPTQGTPVASLDLEQEQLTIKALKELGERQVEKSTSAQRDAELPSEEVLKQTFTF
APESWPQRSYDILERNVKNGSDLGISQKPITIRETTRVDAVSSLSKTELVKKHVLARLLT
DFSVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVI
QAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKL
AVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQ
AKLPGIAKKKAE
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcggagccgtcggcggccactcagtcccattccatctcctcgtcgtccttcggagcc
gagccgtccgcgcccggcggcggcgggagcccaggagcctgccccgccctggggacgaag
agctgcagctcctcctgtgcggattcctttgtttcttcctcttcctctcagcctgtatct
ctattttcgacctcacaagagggattgagctctctttgctctgatgagccatcttcagaa
attatgacttcttcctttctttcatcttctgaaatacataacactggccttacaatacta
catggagaaaaaagccatgtgttagggagccagcctattttagccaaagaaggaaaagac
cacttggatcttctagatatgaaaaagatggaaaagcctcaggggaccagcaacaacgta
tcagactcttcagtttctcttgcagcaggagttcattgtgaccgtccttctattccagcc
agtttcccagagcatcctgcttttctctcaaagaaaattggtcaagtggaagagcaaata
gataaagagaccaagaacccaaatggggtatcaagtagggaggctaaaactgcattggat
gctgatgacagattcactttgctgacagcccagaaaccacctactgagtactctaaggta
gaaggcatttatacatattctttgtctccatccaaagtttcaggagatgatgttattgaa
aaggattcccctgaatcaccatttgaagtaattattgacaaagcagcatttgacaaagaa
tttaaagactcatataaggagagcacagatgattttggtagctggtctgtgcacactgat
aaagaatcatccgaagacatttcagagactaatgacaagctttttccactgagaaataaa
gaggcaggacgttacccaatgtctgcattgctcagtaggcagttttcacacacaaatgca
gcactggaagaggtgtccagatgcgtgaatgatatgcataactttactaacgaaatactg
acttgggatctggttccccaagtgaaacaacagaccgataaatcttctgactgcatcaca
aaaactacaggacttgacatgagtgaatataattcagaaattccagttgtaaatcttaaa
actagcactcatcagaaaactcctgtatgttctattgatgggagcactcccatcactaaa
tcaacaggtgattgggcagaagcatctctccagcaagaaaatgctattactggaaaacct
gtacctgactctttgaattccacaaaagaattcagtatcaaaggtgtgcaaggcaatatg
cagaaacaggatgacacacttgcagaattacctggatctccacctgagaaatgtgactct
ttgggttctggagtggccacagtgaaagtggttttacctgatgaccacctgaaagatgaa
atggactggcagagctctgcattgggagaaatcacagaagctgatagttctggtgagtct
gatgacacagtaatagaggacatcacagcagatacatcatttgaaaataacaaaattcag
gctgaaaaacctgtttccattccaagtgctgttgtaaaaacaggtgaaagagaaatcaaa
gagattcccagttgtgagagagaagaaaaaacatctaaaaactttgaagaattggtcagt
gactctgagctgcatcaagatcagcctgatattcttggaaggagtccagctagtgaggca
gcatgttcaaaagtacccgatacgaatgtctccttagaagatgtgagtgaagttgctcct
gaaaagcctattactactgagaaccccaaacttccttcaacagtgtctccaaatgttttt
aatgagacagaattctcattaaatgtgacaacatctgcctatttggagtcattacatggg
aaaaatgttaaacatatagatgattcctccccagaggacctgatagcagcctttacagaa
accagagataaaggaatagtagatagtgaaagaaatgcttttaaagcaatatcagagaag
atgacagactttaaaacaactcctcctgtagaagtcttacatgaaaatgagtccggtggt
tctgaaattaaagacattggaagcaaatacagtgaacaaagcaaagaaacaaatggaagt
gagcctctaggtgttttccctacccaaggtactccagtagcatctcttgacttagaacaa
gaacagctcacaattaaggctcttaaagaattaggtgaaagacaggttgagaagtcaact
tctgcacagcgtgacgcagaattgccttctgaagaagtactgaagcaaactttcacattt
gctccagaatcttggccacagagatcatatgacatcctagaacgtaatgtcaagaatgga
tctgatcttgggatttcccagaagcccatcactatcagagaaactactagggtagatgct
gtttccagccttagcaagactgaattggtaaaaaagcatgtcctagcaagacttctgaca
gacttctcagtgcacgatctgattttctggagagatgtgaagaagactgggtttgtcttt
ggcaccacgctgatcatgctgctttccctggcagctttcagtgtcatcagtgtggtttct
tacctcatcctggctcttctctctgtcaccatcagcttcaggatctacaagtccgtcatc
caagctgtacagaagtcagaagaaggccatccattcaaagcctacctggacgtagacatt
actctgtcctcagaagctttccataattacatgaatgctgccatggtgcacatcaacagg
gccctgaaactcattattcgtctctttctggtagaagatctggttgactccttgaagctg
gctgtcttcatgtggctgatgacctatgttggtgctgtttttaacggaatcacccttcta
attcttgctgaactgctcattttcagtgtcccgattgtctatgagaagtacaagacccag
attgatcactatgttggcatcgcccgagatcagaccaagtcaattgttgaaaagatccaa
gcaaaactccctggaatcgccaaaaaaaaggcagaataa

DBGET integrated database retrieval system