KEGG   Homo sapiens (human): 10314Help
Entry
10314             CDS       T01001                                 

Gene name
LANCL1, GPR69A, p40
Definition
(RefSeq) LanC like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LANC_like Glyco_hydro_127 Glyco_hydro_88
Motif
Other DBs
NCBI-GeneID: 10314
NCBI-ProteinID: NP_001130046
OMIM: 604155
HGNC: 6508
Ensembl: ENSG00000115365
Vega: OTTHUMG00000132991
Pharos: O43813(Tbio)
UniProt: O43813 Q53TN2
Structure
PDB: 

Position
2q34
AA seq 399 aa AA seqDB search
MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGT
GYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVL
YHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQ
QICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKL
HSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLC
DAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGE
HGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagggccttcccgaatccttatgctgattataacaaatccctggccgaaggc
tactttgatgctgccgggaggctgactcctgagttctcacaacgcttgaccaataagatt
cgggagcttcttcagcaaatggagagaggcctgaaatcagcagaccctcgggatggcacc
ggttacactggctgggcaggtattgctgtgctttacttacatctttatgatgtatttggg
gaccctgcctacctacagttagcacatggctatgtaaagcaaagtctgaactgcttaacc
aagcgctccatcaccttcctttgtggggatgcaggccccctggcagtggccgctgtgcta
tatcacaagatgaacaatgagaagcaggcagaagattgcatcacacggctaattcaccta
aataagattgatcctcatgctccaaatgaaatgctctatgggcgaataggctacatctat
gctcttctttttgtcaataagaactttggagtggaaaagattcctcaaagccatattcag
cagatttgtgaaacaattttaacctctggagaaaacctagctaggaagagaaacttcacg
gcaaagtctccactgatgtatgaatggtaccaggaatattatgtaggggctgctcatggc
ctggctggaatttattactacctgatgcagcccagccttcaagtgagccaagggaagtta
catagtttggtcaagcccagtgtagactacgtctgccagctgaaattcccttctggcaat
taccctccatgtataggtgataatcgagatctgcttgtccattggtgccatggcgcccct
ggggtaatctacatgctcatccaggcctataaggtattcagagaggaaaagtatctctgt
gatgcctatcagtgtgctgatgtgatctggcaatatgggttgctgaagaagggatatggg
ctgtgccacggttctgcagggaatgcctatgccttcctgacactctacaacctcacacag
gacatgaagtacctgtatagggcctgtaagtttgctgaatggtgcttagagtatggagaa
catggatgcagaacaccagacacccctttctctctctttgaaggaatggctggaacaata
tatttcctggctgacctgctagtccccacaaaagccaggttccctgcatttgaactctga

DBGET integrated database retrieval system