KEGG   Homo sapiens (human): 10317Help
Entry
10317             CDS       T01001                                 

Gene name
B3GALT5, B3GalT-V, B3GalTx, B3T5, GLCT5, beta-1,3-GalTase_5, beta-3-Gx-T5, beta3Gal-T5
Definition
(RefSeq) beta-1,3-galactosyltransferase 5
  KO
K03877  beta-1,3-galactosyltransferase 5 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hsa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
hsa01100  Metabolic pathways
Module
hsa_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    10317 (B3GALT5)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    10317 (B3GALT5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    10317 (B3GALT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     10317 (B3GALT5)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 1 chain
   10317 (B3GALT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T Fringe
Motif
Other DBs
NCBI-GeneID: 10317
NCBI-ProteinID: NP_001265579
OMIM: 604066
HGNC: 920
Ensembl: ENSG00000183778
Vega: OTTHUMG00000086725
Pharos: Q9Y2C3(Tbio)
UniProt: Q9Y2C3
Position
21q22.2
AA seq 310 aa AA seqDB search
MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLV
LLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDII
QKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFF
TGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIK
LEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALE
NSRGEDCPPV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggctttcccgaagatgagattgatgtatatttgccttctggttctgggggctctttgt
ttgtattttagcatgtacagtctaaatcctttcaaagaacagtcctttgtttacaagaaa
gacgggaacttccttaagctcccagatacagactgcaggcagacacctcccttcctcgtc
ctgctggtgacctcatcccacaaacagttggctgagcgcatggccatccggcagacgtgg
gggaaagagaggatggtgaagggaaagcagctgaagacattcttcctcctggggaccacc
agcagtgcagcggaaacgaaagaggtggaccaggagagccagcgacacggggacattatc
cagaaggatttcctagacgtctattacaatctgaccctgaagaccatgatgggcatagaa
tgggtccatcgcttttgtcctcaggcggcgtttgtgatgaaaacagactcagacatgttc
atcaatgttgactatctgactgaactgcttctgaagaaaaacagaacaaccaggtttttc
actggcttcttgaaactcaatgagtttcccatcaggcagccattcagcaagtggtttgtc
agtaaatctgaatatccgtgggacaggtacccaccattctgctccggcaccggctacgtg
ttttctggcgacgtggcgagtcaggtgtacaatgtctccaagagcgtcccatacattaaa
ctggaagacgtgtttgtggggctctgcctcgaaaggctgaacatcagattggaggagctc
cactcccagccgaccttttttccagggggcttacgcttctccgtatgcctcttcaggagg
atcgtggcctgccacttcatcaagcctcggactctcttggactactggcaggctctagag
aattcccggggggaagattgtccgcctgtctga

DBGET integrated database retrieval system