KEGG   Homo sapiens (human): 10325Help
Entry
10325             CDS       T01001                                 

Gene name
RRAGB, RAGB, bA465E19.1
Definition
(RefSeq) Ras related GTP binding B
  KO
K16185  Ras-related GTP-binding protein A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    10325 (RRAGB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10325 (RRAGB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10325 (RRAGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gtr1_RagA Roc Ras Arf MMR_HSR1 ABC_tran PduV-EutP AAA_24 SecA_DEAD
Motif
Other DBs
NCBI-GeneID: 10325
NCBI-ProteinID: NP_057740
OMIM: 300725
HGNC: 19901
Ensembl: ENSG00000083750
Vega: OTTHUMG00000021662
Pharos: Q5VZM2(Tbio)
UniProt: Q5VZM2
Position
Xp11.21
AA seq 374 aa AA seqDB search
MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSII
FANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLN
LWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPD
AKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQ
LIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFK
LSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEK
LERVDGPKQCLLMR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatctgactctgagaaaacgacggagaaagaaaatctggggccgagaatggat
ccaccactaggggaaccggaaggatcgcttgggtgggtgctaccaaatacagccatgaag
aaaaaggtgctgttgatgggtaaaagtgggtctggtaagaccagcatgaggtctattatc
tttgcaaattatattgccagagacacacgtcgccttggcgcaacaatactagaccgtata
catagtcttcaaattaatagcagtttgagcacctactctctcgtagactctgttggaaat
acaaagacatttgatgtagaacattctcatgttcgatttctgggaaacctggtattgaac
ctgtgggattgtggtgggcaagacaccttcatggaaaattatttcactagccaacgggac
aacatcttccgaaatgtggaggttctgatttatgtctttgatgtggagagccgcgaactg
gaaaaggacatgcactattaccaatcatgcctggaggccattctgcagaattctccagat
gccaaaatattttgcttggtacacaaaatggatctggtacaggaggatcaacgggacctg
atttttaaagagcgagaagaagatttgaggcgtttgtctcgcccattggaatgttcttgt
ttccgaacatctatctgggatgaaaccctctataaggcttggtccagcatagtttatcag
ctgattcccaatgttcagcagctggaaatgaacctaaggaattttgctgaaattatcgaa
gctgatgaagtacttctttttgagagagctacttttctggtaatttctcactatcagtgt
aaagagcagcgtgatgcccatagatttgagaaaataagcaacattattaagcagttcaag
ctgagctgcagcaagctggctgcctctttccagagtatggaagtcaggaactctaacttc
gctgctttcattgacatctttacatccaacacttatgtgatggttgtgatgtctgatccg
tccattccttctgcagctactctgatcaacatccgcaatgccaggaaacactttgaaaag
ctggaaagagtggatggaccaaagcagtgtcttctcatgcgctaa

KEGG   Homo sapiens (human): 10670Help
Entry
10670             CDS       T01001                                 

Gene name
RRAGA, FIP-1, FIP1, RAGA
Definition
(RefSeq) Ras related GTP binding A
  KO
K16185  Ras-related GTP-binding protein A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    10670 (RRAGA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10670 (RRAGA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10670 (RRAGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gtr1_RagA Roc Ras Arf MMR_HSR1 GTP_EFTU SRPRB DUF815 PduV-EutP ABC_tran SecA_DEAD AAA_24 AAA_29
Motif
Other DBs
NCBI-GeneID: 10670
NCBI-ProteinID: NP_006561
OMIM: 612194
HGNC: 16963
Ensembl: ENSG00000155876
Vega: OTTHUMG00000019621
Pharos: Q7L523(Tbio)
UniProt: Q7L523
Structure
PDB: 

Position
9p22.1
AA seq 313 aa AA seqDB search
MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNL
WDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDA
KIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQL
IPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKL
SCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKL
ERVDGPKHSLLMR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatacagccatgaagaaaaaggtgctgctgatggggaagagcgggtcggggaag
accagcatgaggtcgataatcttcgccaattacattgctcgcgacacccggcgcctgggg
gccaccattgacgtggaacactcccacgtccgattcctagggaacctggtgctgaacctg
tgggactgtggcggtcaggacaccttcatggaaaattacttcaccagccagcgagacaat
atcttccgtaacgtggaagttttgatttacgtgtttgacgtggagagccgcgaactggaa
aaggacatgcattattaccagtcgtgtctggaggccatcctccagaactctcctgacgcc
aaaatcttctgcctggtgcacaaaatggatctggttcaggaggatcagcgtgacctgatt
tttaaagagcgagaggaagacctgaggcgtctgtctcgcccgctggagtgtgcttgtttt
cgaacgtccatctgggatgagacgctctacaaagcctggtccagcatcgtctaccagctg
attcccaacgttcagcagctggagatgaacctcaggaattttgcccaaatcattgaggcc
gatgaagttctgctgttcgaaagagctacattcttggttatttcccactaccagtgcaaa
gagcagcgcgacgtccaccggtttgagaagatcagcaacatcatcaaacagttcaagctg
agctgcagtaaattggccgcttccttccagagcatggaagttaggaattccaacttcgct
gctttcatcgacatcttcacctcaaatacgtacgtgatggtggtcatgtcagatccgtcg
atcccttctgcggccactctgatcaacattcgcaatgcccggaaacactttgagaagctg
gagagagtggatggccccaagcacagtctccttatgcgttga

DBGET integrated database retrieval system