KEGG   Homo sapiens (human): 10327Help
Entry
10327             CDS       T01001                                 

Gene name
AKR1A1, ALDR1, ALR, ARM, DD3, HEL-S-6
Definition
(RefSeq) aldo-keto reductase family 1 member A1
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00040  Pentose and glucuronate interconversions
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    10327 (AKR1A1)
   00040 Pentose and glucuronate interconversions
    10327 (AKR1A1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    10327 (AKR1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10327 (AKR1A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     10327 (AKR1A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10327 (AKR1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 10327
NCBI-ProteinID: NP_001189342
OMIM: 103830
HGNC: 380
Ensembl: ENSG00000117448
Vega: OTTHUMG00000007740
Pharos: P14550(Tchem)
UniProt: P14550 V9HWI0
Structure
PDB: 

Position
1p34.1
AA seq 325 aa AA seqDB search
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEAL
KEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEK
YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV
PMLTVDGKRVPRDAGHPLYPFNDPY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcctgtgttctactgcacactgggcagaagatgcctctgattggtctgggt
acctggaagagtgagcctggtcaggtaaaagcagctgttaagtatgcccttagcgtaggc
taccgccacattgattgtgctgctatctacggcaatgagcctgagattggggaggccctg
aaggaggacgtgggaccaggcaaggcggtgcctcgggaggagctgtttgtgacatccaag
ctgtggaacaccaagcaccaccccgaggatgtggagcctgccctccggaagactctggct
gacctccagctggagtatctggacctgtacctgatgcactggccttatgcctttgagcgg
ggagacaaccccttccccaagaatgctgatgggactatatgctacgactccacccactac
aaggagacttggaaggctctggaggcactggtggctaaggggctggtgcaggcgctgggc
ctgtccaacttcaacagtcggcagattgatgacatactcagtgtggcctccgtgcgtcca
gctgtcttgcaggtggaatgccacccatacttggctcaaaatgagctaattgcccactgc
caagcacgtggcctggaggtaactgcttatagccctttgggctcctctgatcgtgcatgg
cgtgatcctgatgagcctgtcctgctggaggaaccagtagtcctggcattggctgaaaag
tatggccgatctccagctcagatcttgctcaggtggcaggtccagcggaaagtgatctgc
atccccaaaagtatcactccttctcgaatccttcagaacatcaaggtgtttgacttcacc
tttagcccagaagagatgaagcagctaaatgccctgaacaaaaattggagatatattgtg
cctatgcttacggtggatgggaagagagtcccaagggatgcagggcatcctctgtacccc
tttaatgacccgtactga

DBGET integrated database retrieval system