KEGG   Homo sapiens (human): 10327
Entry
10327             CDS       T01001                                 

Symbol
AKR1A1, ALDR1, ALR, ARM, DD3, HEL-S-6
Name
(RefSeq) aldo-keto reductase family 1 member A1
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00561  Glycerolipid metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
hsa05208  Chemical carcinogenesis - reactive oxygen species
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Network
nt06226  KEAP1-NRF2 signaling
nt06251  CYP-mediated ROS formation
  Element
N01401  Benzo[a]pyrenre to CYP-mediated metabolism
N01413  Metals to KEAP1-NRF2 signalig pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    10327 (AKR1A1)
   00040 Pentose and glucuronate interconversions
    10327 (AKR1A1)
   00053 Ascorbate and aldarate metabolism
    10327 (AKR1A1)
   00620 Pyruvate metabolism
    10327 (AKR1A1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    10327 (AKR1A1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    10327 (AKR1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10327 (AKR1A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     10327 (AKR1A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10327 (AKR1A1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 10327
NCBI-ProteinID: NP_001189342
OMIM: 103830
HGNC: 380
Ensembl: ENSG00000117448
Vega: OTTHUMG00000007740
Pharos: P14550(Tchem)
UniProt: P14550 V9HWI0
Structure
PDB: 
2ALR

Position
1p34.1
AA seq 325 aa
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEAL
KEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEK
YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV
PMLTVDGKRVPRDAGHPLYPFNDPY
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcggcttcctgtgttctactgcacactgggcagaagatgcctctgattggtctgggt
acctggaagagtgagcctggtcaggtaaaagcagctgttaagtatgcccttagcgtaggc
taccgccacattgattgtgctgctatctacggcaatgagcctgagattggggaggccctg
aaggaggacgtgggaccaggcaaggcggtgcctcgggaggagctgtttgtgacatccaag
ctgtggaacaccaagcaccaccccgaggatgtggagcctgccctccggaagactctggct
gacctccagctggagtatctggacctgtacctgatgcactggccttatgcctttgagcgg
ggagacaaccccttccccaagaatgctgatgggactatatgctacgactccacccactac
aaggagacttggaaggctctggaggcactggtggctaaggggctggtgcaggcgctgggc
ctgtccaacttcaacagtcggcagattgatgacatactcagtgtggcctccgtgcgtcca
gctgtcttgcaggtggaatgccacccatacttggctcaaaatgagctaattgcccactgc
caagcacgtggcctggaggtaactgcttatagccctttgggctcctctgatcgtgcatgg
cgtgatcctgatgagcctgtcctgctggaggaaccagtagtcctggcattggctgaaaag
tatggccgatctccagctcagatcttgctcaggtggcaggtccagcggaaagtgatctgc
atccccaaaagtatcactccttctcgaatccttcagaacatcaaggtgtttgacttcacc
tttagcccagaagagatgaagcagctaaatgccctgaacaaaaattggagatatattgtg
cctatgcttacggtggatgggaagagagtcccaagggatgcagggcatcctctgtacccc
tttaatgacccgtactga

DBGET integrated database retrieval system