KEGG   Homo sapiens (human): 10332
Entry
10332             CDS       T01001                                 
Symbol
CLEC4M, CD209L, CD299, DC-SIGN2, DC-SIGNR, DCSIGNR, HP10347, L-SIGN, LSIGN
Name
(RefSeq) C-type lectin domain family 4 member M
  KO
K06563  C-type lectin domain family 4 member M
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04625  C-type lectin receptor signaling pathway
hsa05152  Tuberculosis
hsa05162  Measles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    10332 (CLEC4M)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    10332 (CLEC4M)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    10332 (CLEC4M)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    10332 (CLEC4M)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10332 (CLEC4M)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    10332 (CLEC4M)
   04090 CD molecules [BR:hsa04090]
    10332 (CLEC4M)
   04091 Lectins [BR:hsa04091]
    10332 (CLEC4M)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    10332 (CLEC4M)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   10332 (CLEC4M)
CD molecules [BR:hsa04090]
 Proteins
  10332 (CLEC4M)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    10332 (CLEC4M)
SSDB
Motif
Pfam: Lectin_C DUF2170 DUF2730 Occludin_ELL Syntaxin_2 DUF4763 NPV_P10 Vps5 Tup_N GIT1_C DUF2357 Com_YlbF DUF4363 UL45 DUF1826 baeRF_family3 FUSC
Other DBs
NCBI-GeneID: 10332
NCBI-ProteinID: NP_055072
OMIM: 605872
HGNC: 13523
Ensembl: ENSG00000104938
Pharos: Q9H2X3(Tbio)
UniProt: Q9H2X3
Structure
Position
19:7763243..7769605
AA seq 399 aa
MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFML
LAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLK
AAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQE
IYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGE
LPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVR
AQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEP
NNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgagtgactccaaggaaccaagggtgcagcagctgggcctcctggaagaagatccaaca
accagtggcatcagactttttccaagagactttcaattccagcagatacatggccacaag
agctctacagggtgtcttggccatggcgccctggtgctgcaactcctctccttcatgctc
ttggctggggtcctggtggccatccttgtccaagtgtccaaggtccccagctccctaagt
caggaacaatccgagcaagacgcaatctaccagaacctgacccagcttaaagctgcagtg
ggtgagctctcagagaaatccaagctgcaggagatctaccaggagctgacccagctgaag
gctgcagtgggtgagttgccagagaaatccaagctgcaggagatctaccaggagctgacc
cggctgaaggctgcagtgggtgagttgccagagaaatccaagctgcaggagatctaccag
gagctgacccggctgaaggctgcagtgggtgagttgccagagaaatccaagctgcaggag
atctaccaggagctgacccggctgaaggctgcagtgggtgagttgccagagaaatccaag
ctgcaggagatctaccaggagctgacggagctgaaggctgcagtgggtgagttgccagag
aaatccaagctgcaggagatctaccaggagctgacccagctgaaggctgcagtgggtgag
ttgccagaccagtccaagcagcagcaaatctatcaagaactgaccgatttgaagactgca
tttgaacgcctgtgccgccactgtcccaaggactggacattcttccaaggaaactgttac
ttcatgtctaactcccagcggaactggcacgactccgtcaccgcctgccaggaagtgagg
gcccagctcgtcgtaatcaaaactgctgaggagcagaacttcctacagctgcagacttcc
aggagtaaccgcttctcctggatgggactttcagacctaaatcaggaaggcacgtggcaa
tgggtggacggctcacctctgtcacccagcttccagcggtactggaacagtggagaaccc
aacaatagcgggaatgaagactgtgcggaatttagtggcagtggctggaacgacaatcga
tgtgacgttgacaattactggatctgcaaaaagcccgcagcctgcttcagagacgaatag

DBGET integrated database retrieval system