KEGG   Homo sapiens (human): 10333
Entry
10333             CDS       T01001                                 

Gene name
TLR6, CD286
Definition
(RefSeq) toll like receptor 6
  KO
K10169  toll-like receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05142  Chagas disease
hsa05152  Tuberculosis
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    10333 (TLR6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    10333 (TLR6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10333 (TLR6)
   05152 Tuberculosis
    10333 (TLR6)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    10333 (TLR6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    10333 (TLR6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10333 (TLR6)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    10333 (TLR6)
   04090 CD molecules [BR:hsa04090]
    10333 (TLR6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    10333 (TLR6)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   10333 (TLR6)
CD molecules [BR:hsa04090]
 Proteins
  10333 (TLR6)
SSDB
Motif
Pfam: TIR LRR_8 TIR_2 LRR_4 LRR_6 LRRCT LRR_9
Other DBs
NCBI-GeneID: 10333
NCBI-ProteinID: NP_006059
OMIM: 605403
HGNC: 16711
Ensembl: ENSG00000174130
Vega: OTTHUMG00000128579
Pharos: Q9Y2C9(Tbio)
UniProt: Q9Y2C9 B2R933
Structure
PDB: 
4OM7

Position
4p14
AA seq 796 aa
MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMS
QNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPI
VSFRHLDLSFNDFKALPICKEFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRN
YYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIK
FLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
KTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNF
TQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH
KENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNV
AFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREF
VKNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAV
TVTSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSEHDSAWVKSEL
VPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAH
HNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKRGLFWANIRAA
FNMKLTLVTENNDVKS
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgaccaaagacaaagaacctattgttaaaagcttccattttgtttgccttatgatcata
atagttggaaccagaatccagttctccgacggaaatgaatttgcagtagacaagtcaaaa
agaggtcttattcatgttccaaaagacctaccgctgaaaaccaaagtcttagatatgtct
cagaactacatcgctgagcttcaggtctctgacatgagctttctatcagagttgacagtt
ttgagactttcccataacagaatccagctacttgatttaagtgttttcaagttcaaccag
gatttagaatatttggatttatctcataatcagttgcaaaagatatcctgccatcctatt
gtgagtttcaggcatttagatctctcattcaatgatttcaaggccctgcccatctgtaag
gaatttggcaacttatcacaactgaatttcttgggattgagtgctatgaagctgcaaaaa
ttagatttgctgccaattgctcacttgcatctaagttatatccttctggatttaagaaat
tattatataaaagaaaatgagacagaaagtctacaaattctgaatgcaaaaacccttcac
cttgtttttcacccaactagtttattcgctatccaagtgaacatatcagttaatacttta
gggtgcttacaactgactaatattaaattgaatgatgacaactgtcaagttttcattaaa
tttttatcagaactcaccagaggttcaaccttactgaattttaccctcaaccacatagaa
acgacttggaaatgcctggtcagagtctttcaatttctttggcccaaacctgtggaatat
ctcaatatttacaatttaacaataattgaaagcattcgtgaagaagattttacttattct
aaaacgacattgaaagcattgacaatagaacatatcacgaaccaagtttttctgttttca
cagacagctttgtacaccgtgttttctgagatgaacattatgatgttaaccatttcagat
acaccttttatacacatgctgtgtcctcatgcaccaagcacattcaagtttttgaacttt
acccagaacgttttcacagatagtatttttgaaaaatgttccacgttagttaaattggag
acacttatcttacaaaagaatggattaaaagaccttttcaaagtaggtctcatgacgaag
gatatgccttctttggaaatactggatgttagctggaattctttggaatctggtagacat
aaagaaaactgcacttgggttgagagtatagtggtgttaaatttgtcttcaaatatgctt
actgactctgttttcagatgtttacctcccaggatcaaggtacttgatcttcacagcaat
aaaataaagagcgttcctaaacaagtcgtaaaactggaagctttgcaagaactcaatgtt
gctttcaattctttaactgaccttcctggatgtggcagctttagcagcctttctgtattg
atcattgatcacaattcagtttcccacccatcggctgatttcttccagagctgccagaag
atgaggtcaataaaagcaggggacaatccattccaatgtacctgtgagctaagagaattt
gtcaaaaatatagaccaagtatcaagtgaagtgttagagggctggcctgattcttataag
tgtgactacccagaaagttatagaggaagcccactaaaggactttcacatgtctgaatta
tcctgcaacataactctgctgatcgtcaccatcggtgccaccatgctggtgttggctgtg
actgtgacctccctctgcatctacttggatctgccctggtatctcaggatggtgtgccag
tggacccagactcggcgcagggccaggaacatacccttagaagaactccaaagaaacctc
cagtttcatgcttttatttcatatagtgaacatgattctgcctgggtgaaaagtgaattg
gtaccttacctagaaaaagaagatatacagatttgtcttcatgagagaaactttgtccct
ggcaagagcattgtggaaaatatcatcaactgcattgagaagagttacaagtccatcttt
gttttgtctcccaactttgtccagagtgagtggtgccattacgaactctattttgcccat
cacaatctctttcatgaaggatctaataacttaatcctcatcttactggaacccattcca
cagaacagcattcccaacaagtaccacaagctgaaggctctcatgacgcagcggacttat
ttgcagtggcccaaggagaaaagcaaacgtgggctcttttgggctaacattagagccgct
tttaatatgaaattaacactagtcactgaaaacaatgatgtgaaatcttaa

KEGG   Homo sapiens (human): 7096
Entry
7096              CDS       T01001                                 

Gene name
TLR1, CD281, TIL, TIL._LPRS5, rsc786
Definition
(RefSeq) toll like receptor 1
  KO
K05398  toll-like receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa05152  Tuberculosis
Disease
H00344  Leprosy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7096 (TLR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    7096 (TLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    7096 (TLR1)
   04090 CD molecules [BR:hsa04090]
    7096 (TLR1)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   7096 (TLR1)
CD molecules [BR:hsa04090]
 Proteins
  7096 (TLR1)
SSDB
Motif
Pfam: TIR LRR_8 TIR_2 LRR_4 LRR_9 LRRCT Tautomerase
Other DBs
NCBI-GeneID: 7096
NCBI-ProteinID: NP_003254
OMIM: 601194
HGNC: 11847
Ensembl: ENSG00000174125
Vega: OTTHUMG00000160413
Pharos: Q15399(Tbio)
UniProt: Q15399
Structure
PDB: 
1FYV

Position
4p14
AA seq 786 aa
MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISEL
WTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLD
LSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKED
PEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKL
QTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLK
ALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLL
TDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS
WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSL
TDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNID
QVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSL
CSYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE
KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFH
EGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAINIKL
TEQAKK
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgactagcatcttccattttgccattatcttcatgttaatacttcagatcagaatacaa
ttatctgaagaaagtgaatttttagttgataggtcaaaaaacggtctcatccacgttcct
aaagacctatcccagaaaacaacaatcttaaatatatcgcaaaattatatatctgagctt
tggacttctgacatcttatcactgtcaaaactgaggattttgataatttctcataataga
atccagtatcttgatatcagtgttttcaaattcaaccaggaattggaatacttggatttg
tcccacaacaagttggtgaagatttcttgccaccctactgtgaacctcaagcacttggac
ctgtcatttaatgcatttgatgccctgcctatatgcaaagagtttggcaatatgtctcaa
ctaaaatttctggggttgagcaccacacacttagaaaaatctagtgtgctgccaattgct
catttgaatatcagcaaggtcttgctggtcttaggagagacttatggggaaaaagaagac
cctgagggccttcaagactttaacactgagagtctgcacattgtgttccccacaaacaaa
gaattccattttattttggatgtgtcagtcaagactgtagcaaatctggaactatctaat
atcaaatgtgtgctagaagataacaaatgttcttacttcctaagtattctggcgaaactt
caaacaaatccaaagttatcaaatcttaccttaaacaacattgaaacaacttggaattct
ttcattaggatcctccagctggtttggcatacaactgtatggtatttctcaatttcaaac
gtgaagctacagggtcagctggacttcagagattttgattattctggcacttccttgaag
gccttgtctatacaccaagttgtcagcgatgtgttcggttttccgcaaagttatatctat
gaaatcttttcgaatatgaacatcaaaaatttcacagtgtctggtacacgcatggtccac
atgctttgcccatccaaaattagcccgttcctgcatttggatttttccaataatctctta
acagacacggtttttgaaaattgtgggcaccttactgagttggagacacttattttacaa
atgaatcaattaaaagaactttcaaaaatagctgaaatgactacacagatgaagtctctg
caacaattggatattagccagaattctgtaagctatgatgaaaagaaaggagactgttct
tggactaaaagtttattaagtttaaatatgtcttcaaatatacttactgacactattttc
agatgtttacctcccaggatcaaggtacttgatcttcacagcaataaaataaagagcatt
cctaaacaagtcgtaaaactggaagctttgcaagaactcaatgttgctttcaattcttta
actgaccttcctggatgtggcagctttagcagcctttctgtattgatcattgatcacaat
tcagtttcccacccatcggctgatttcttccagagctgccagaagatgaggtcaataaaa
gcaggggacaatccattccaatgtacctgtgagctaggagaatttgtcaaaaatatagac
caagtatcaagtgaagtgttagagggctggcctgattcttataagtgtgactacccggaa
agttatagaggaaccctactaaaggactttcacatgtctgaattatcctgcaacataact
ctgctgatcgtcaccatcgttgccaccatgctggtgttggctgtgactgtgacctccctc
tgcagctacttggatctgccctggtatctcaggatggtgtgccagtggacccagacccgg
cgcagggccaggaacatacccttagaagaactccaaagaaatctccagtttcatgcattt
atttcatatagtgggcacgattctttctgggtgaagaatgaattattgccaaacctagag
aaagaaggtatgcagatttgccttcatgagagaaactttgttcctggcaagagcattgtg
gaaaatatcatcacctgcattgagaagagttacaagtccatctttgttttgtctcccaac
tttgtccagagtgaatggtgccattatgaactctactttgcccatcacaatctctttcat
gaaggatctaatagcttaatcctgatcttgctggaacccattccgcagtactccattcct
agcagttatcacaagctcaaaagtctcatggccaggaggacttatttggaatggcccaag
gaaaagagcaaacgtggccttttttgggctaacttaagggcagccattaatattaagctg
acagagcaagcaaagaaatag

DBGET integrated database retrieval system