KEGG   Homo sapiens (human): 10335
Entry
10335             CDS       T01001                                 

Gene name
IRAG1, IRAG, JAW1L, MRVI1
Definition
(RefSeq) inositol 1,4,5-triphosphate receptor associated 1
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    10335 (IRAG1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10335 (IRAG1)
SSDB
Motif
Pfam: MRVI1
Other DBs
NCBI-GeneID: 10335
NCBI-ProteinID: NP_001092049
OMIM: 604673
HGNC: 7237
Ensembl: ENSG00000072952
Vega: OTTHUMG00000165773
Pharos: Q9Y6F6(Tbio)
UniProt: Q9Y6F6
Position
11p15.4
AA seq 904 aa
MGMDLTCPFGISPACGAQASWSIFGADAAEVPGTRGHSQQEAAMPHIPEDEEPPGEPQAA
QSPAGQGPPAAGVSCSPTPTIVLTGDATSPEGETDKNLANRVHSPHKRLSHRHLKVSTAS
LTSVDPAGHIIDLVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRGRKSRSSPGDS
PSAVSPNLSPSASPTSSRSNSLTVPTPPGLDVCSGPPSPLPGAPPQQKGDEADVSSPHPG
EPNVPKGLADRKQNDQRKVSQGRLAPRPPPVEKSKEIAIEQKENFDPLQYPETTPKGLAP
VTNSSGKMALNSPQPGPVESELGKQLLKTGWEGSPLPRSPTQDAAGVGPPASQGRGPAGE
PMGPEAGSKAELPPTVSRPPLLRGLSWDSGPEEPGPRLQKVLAKLPLAEEEKRFAGKAGG
KLAKAPGLKDFQIQVQPVRMQKLTKLREEHILMRNQNLVGLKLPDLSEAAEQEKGLPSEL
SPAIEEEESKSGLDVMPNISDVLLRKLRVHRSLPGSAPPLTEKEVENVFVQLSLAFRNDS
YTLESRINQAERERNLTEENTEKELENFKASITSSASLWHHCEHRETYQKLLEDIAVLHR
LAARLSSRAEVVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEFKKLANQNSSRS
CGPSEDGVPRTARSMSLTLGKNMPRRRVSVAVVPKFNALNLPGQTPSSSSIPSLPALSES
PNGKGSLPVTSALPALLENGKTNGDPDCEASAPALTLSCLEELSQETKARMEEEAYSKGF
QEGLKKTKELQDLKEEEEEQKSESPEEPEEVEETEEEEKGPRSSKLEELVHFLQVMYPKL
CQHWQVIWMMAAVMLVLTVVLGLYNSYNSCAEQADGPLGRSTCSAAQRDSWWSSGLQHEQ
PTEQ
NT seq 2715 nt   +upstreamnt  +downstreamnt
atgggaatggatttgacttgtccttttggcatctccccagcctgtggagcccaggcctct
tggagcatctttggggctgacgcagcggaggttccgggcacacgtggccactcccagcag
gaggctgccatgccccacattcccgaggacgaggagccccccggagagccacaggcagcc
cagagccctgccggccaaggtcctcctgccgcaggagtatcttgcagtccaactcccacg
attgtcctgactggggatgccacttcaccagaaggagaaaccgacaaaaacctggccaac
agagttcacagtccccacaagaggctttctcaccgacacttgaaggtgtccactgcctcc
ctgacatctgtggaccccgcggggcacatcattgacctggtgaatgaccagctgccagac
atcagcatctcagaggaggacaagaagaaaaacctggcgctgctggaagaagccaagttg
gtgagtgagcgattcctgacccgccgtgggaggaagtccaggagcagccccggagactcc
ccatcagctgtttccccgaacctcagccccagcgcttctcctacatcctctcggagcaac
tcacttacagtccccaccccgccaggtttggatgtgtgcagtggcccgccatcccctctg
cctggagcaccaccacagcagaagggggatgaggccgacgtctcttcacctcaccctggc
gagcctaacgtccccaaagggctagctgacaggaagcagaatgaccagaggaaagtgtct
cagggcaggctggctcctcgtcctcctccagttgagaagtccaaagagattgcaatagaa
caaaaggaaaacttcgatcccctccagtaccccgagaccacacccaaaggcctagctcct
gttacaaacagcagtgggaaaatggccctgaacagccctcagcctggccccgtggagagc
gagctggggaagcagctcttgaaaacgggctgggagggcagccctctgccgagaagtcca
acccaggatgcggcaggagtgggtcccccagcctcccaggggagaggcccagctggagag
ccgatggggcccgaggctggctccaaagctgagcttccacccactgtgtcccggcccccg
ctgctgcgagggctctcctgggacagtggccctgaagaacctggcccccggctgcagaaa
gtgcttgccaagctgccactggcagaggaagaaaagcgttttgcaggcaaggccggcggc
aagctggccaaggcccctggtctcaaagactttcagatacaagtgcagcccgtgcggatg
cagaaactgaccaagctccgagaggagcacatcctgatgagaaatcagaacttagtgggg
ctcaagcttccagaccttagtgaagcagctgagcaggaaaaagggcttccttctgaactc
tccccagctattgaggaagaagagtcaaagagtggcttagatgtcatgcctaatatttct
gatgtgctgctgcgcaaactgcgggtccacaggagtctccctggaagtgcccctccactc
actgaaaaggaagttgagaacgtgtttgtgcaactgtccttggcctttagaaatgacagc
tacactctggaatctagaattaaccaggctgaaagggaacgcaacctgacagaggagaac
actgagaaagaactggaaaacttcaaagcttccattacgtcctcagcttcactctggcac
cactgtgagcaccgggaaacctaccagaagttgctggaggacatcgctgtcctgcaccgc
ctggctgcccgcctctccagccgagctgaggtggtaggcgccgtccgccaggaaaagcgc
atgtcgaaagcaacggaagtgatgatgcagtatgtggagaatctaaagaggacgtatgag
aaggaccatgcggagctcatggagtttaaaaagcttgcaaatcagaattcaagccgcagc
tgtggcccctctgaagatggggtccctcgcacggcacggtccatgtccctcacgctggga
aagaatatgcctcgccggagggtcagcgttgctgtggttcctaagtttaatgccctgaat
ctgcctggccaaactcccagctcatcatccattccctccttaccagccttgtcggaatca
cccaatgggaaaggcagcctacctgtcacttcagcactgcctgcacttttggaaaatgga
aagacaaatggggacccagattgtgaagcctctgctcctgcgctgaccctgagctgcctg
gaggagcttagtcaggagaccaaggccaggatggaggaagaagcctacagcaagggattc
caagaaggtctaaagaagaccaaagaacttcaagacctgaaggaggaggaggaagaacag
aagagtgagagtcctgaggaacctgaagaggtagaagaaactgaggaagaggaaaagggc
ccaagaagcagcaaacttgaagaattggtccatttcttacaagtcatgtatcccaaactg
tgtcagcactggcaagtgatctggatgatggctgcagtgatgctggtcttgactgttgtg
ctggggctctacaattcctataactcttgtgcagagcaggctgatgggccccttggaaga
tccacttgctcggcagcccagagggactcctggtggagctcaggactccagcatgagcag
cctacagagcagtag

DBGET integrated database retrieval system