KEGG   Homo sapiens (human): 10342Help
Entry
10342             CDS       T01001                                 

Gene name
TFG, HMSNP, SPG57, TF6, TRKT3
Definition
(RefSeq) TRK-fused gene
  KO
K09292  protein TFG
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
Disease
H00032  Thyroid cancer
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    10342 (TFG)
  09162 Cancers: Specific types
   05216 Thyroid cancer
    10342 (TFG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PB1
Motif
Other DBs
NCBI-GeneID: 10342
NCBI-ProteinID: NP_001007566
OMIM: 602498
HGNC: 11758
Ensembl: ENSG00000114354
Vega: OTTHUMG00000159085
Pharos: Q92734(Tbio)
UniProt: Q92734
Position
3q12.2
AA seq 400 aa AA seqDB search
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKN
VMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIE
GQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAP
APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPR
PGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacagttggatctaagtgggaagctaatcatcaaagctcaacttggggaggat
attcggcgaattcctattcataatgaagatattacttatgatgaattagtgctaatgatg
caacgagttttcagaggaaaacttctgagtaatgatgaagtaacaataaagtataaagat
gaagatggagatcttataacaatttttgatagttctgacctttcctttgcaattcagtgc
agtaggatactgaaactgacattatttgttaatggccagccaagaccccttgaatcaagt
caggtgaaatatctccgtcgagaactgatagaacttcgaaataaagtgaatcgtttattg
gatagcttggaaccacctggagaaccaggaccttccaccaatattcctgaaaatgatact
gtggatggtagggaagaaaagtctgcttctgattcttctggaaaacagtctactcaggtt
atggcagcaagtatgtctgcttttgatcctttaaaaaaccaagatgaaatcaataaaaat
gttatgtcagcgtttggcttaacagatgatcaggtttcagggccacccagtgctcctgca
gaagatcgttcaggaacacccgacagcattgcttcctcctcctcagcagctcacccacca
ggcgttcagccacagcagccaccatatacaggagctcagactcaagcaggtcagattgaa
ggtcagatgtaccaacagtaccagcaacaggccggctatggtgcacagcagccgcaggct
ccacctcagcagcctcaacagtatggtattcagtattcagcaagctatagtcagcagact
ggacctcaacaacctcagcagttccagggatatggccagcaaccaacttcccaggcacca
gctcctgccttttctggtcagcctcaacaactgcctgctcagccgccacagcagtaccag
gcgagcaattatcctgcacaaacttacactgcccaaacttctcagcctactaattatact
gtggctcctgcctctcaacctggaatggctccaagccaacctggggcctatcaaccaaga
ccaggttttacttcacttcctggaagtaccatgacccctcctccaagtgggcctaatcct
tatgcgcgtaaccgtcctccctttggtcagggctatacccaacctggacctggttatcga
taa

DBGET integrated database retrieval system