KEGG   Homo sapiens (human): 10344Help
Entry
10344             CDS       T01001                                 

Gene name
CCL26, IMAC, MIP-4a, MIP-4alpha, SCYA26, TSC-1
Definition
(RefSeq) C-C motif chemokine ligand 26
  KO
K21096  C-C motif chemokine 26
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Disease
H01360  Allergic rhinitis
H01361  Eosinophilic esophagitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10344 (CCL26)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10344 (CCL26)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10344 (CCL26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10344 (CCL26)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10344 (CCL26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 Gln_deamidase_2
Motif
Other DBs
NCBI-GeneID: 10344
NCBI-ProteinID: NP_006063
OMIM: 604697
HGNC: 10625
Ensembl: ENSG00000006606
Vega: OTTHUMG00000130403
Pharos: Q9Y258(Tbio)
UniProt: Q9Y258
Structure
PDB: 

Position
7q11.23
AA seq 94 aa AA seqDB search
MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQR
AVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcctctccttggcctctgctgtgctcctggcctccctcctgagtctccacctt
ggaactgccacacgtgggagtgacatatccaagacctgctgcttccaatacagccacaag
ccccttccctggacctgggtgcgaagctatgaattcaccagtaacagctgctcccagcgg
gctgtgatattcactaccaaaagaggcaagaaagtctgtacccatccaaggaaaaaatgg
gtgcaaaaatacatttctttactgaaaactccgaaacaattgtga

DBGET integrated database retrieval system