KEGG   Homo sapiens (human): 10345Help
Entry
10345             CDS       T01001                                 

Gene name
TRDN, CPVT5, TDN, TRISK
Definition
(RefSeq) triadin
  KO
K23449  triadin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04260  Cardiac muscle contraction
Disease
H01019  Catecholaminergic polymorphic ventricular tachycardia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    10345 (TRDN)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    10345 (TRDN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp-B-Hydro_N
Motif
Other DBs
NCBI-GeneID: 10345
NCBI-ProteinID: NP_006064
OMIM: 603283
HGNC: 12261
Ensembl: ENSG00000186439
Vega: OTTHUMG00000015497
Pharos: Q13061(Tbio)
UniProt: Q13061
Position
6q22.31
AA seq 729 aa AA seqDB search
MTEITAEGNASTTTTVIDSKNGSVPKSPGKVLKRTVTEDIVTTFSSPAAWLLVIALIITW
SAVAIVMFDLVDYKNFSASSIAKIGSDPLKLVRDAMEETTDWIYGFFSLLSDIISSEDEE
DDDGDEDTDKGEIDEPPLRKKEIHKDKTEKQEKPERKIQTKVTHKEKEKGKEKVREKEKP
EKKATHKEKIEKKEKPETKTLAKEQKKAKTAEKSEEKTKKEVKGGKQEKVKQTAAKVKEV
QKTPSKPKEKEDKEKAAVSKHEQKDQYAFCRYMIDIFVHGDLKPGQSPAIPPPLPTEQAS
RPTPASPALEEKEGEKKKAEKKVTSETKKKEKEDIKKKSEKETAIDVEKKEPGKASETKQ
GTVKIAAQAAAKKDEKKEDSKKTKKPAEVEQPKGKKQEKKEKHVEPAKSPKKEHSVPSDK
QVKAKTERAKEEIGAVSIKKAVPGKKEEKTTKTVEQEIRKEKSGKTSSILKDKEPIKGKE
EKVPASLKEKEPETKKDEKMSKAGKEVKPKPPQLQGKKEEKPEPQIKKEAKPAISEKVQI
HKQDIVKPEKTVSHGKPEEKVLKQVKAVTIEKTAKPKPTKKAEHREREPPSIKTDKPKPT
PKGTSEVTESGKKKTEISEKESKEKADMKHLREEKVSTRKESLQLHNVTKAEKPARVSKD
VEDVPASKKAKEGTEDVSPTKQKSPISFFQCVYLDGYNGYGFQFPFTPADRPGESSGQAN
SPGQKQQGQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatcactgctgaaggaaatgcatctacaaccacaactgtgatagacagcaaa
aatggatctgtgcccaaatcccccggaaaagtgctgaagaggacagtcacagaagacata
gtgacgacgttcagctcccctgcagcctggcttctggtcattgccctgataatcacgtgg
tcagctgttgccatcgttatgtttgatttagtggattacaaaaacttttcagcaagctct
attgccaagattggctcagatcctttaaaactggtacgtgatgctatggaggaaaccacg
gactggatctatggcttcttttctttgttatctgacatcatctcatctgaagatgaagaa
gatgatgatggtgacgaagatactgataaaggagaaatagatgagcctcccttgagaaaa
aaagaaatacacaaagataagactgaaaaacaagagaaacctgaaaggaaaatacaaact
aaagttacacacaaagaaaaagaaaaaggaaaagaaaaagtaagagaaaaagaaaaacct
gaaaagaaagcaactcacaaggaaaaaattgagaaaaaagaaaaaccagaaacaaagaca
ctggcgaaagaacagaagaaagctaagactgcagaaaagagtgaagaaaagactaaaaag
gaagtgaaaggtggaaaacaggagaaagtgaagcaaacagctgcaaaagtaaaagaagta
cagaaaacaccatcaaaacccaaagaaaaggaggacaaagagaaagcagctgtgtcaaag
catgaacagaaagatcagtatgcattctgtcgatatatgattgacatatttgtccatggg
gatttaaaaccaggacaaagcccagccattccacctcccttaccgacagaacaagcttcc
agacccactccggcatcacctgcccttgaagaaaaagaaggggaaaagaagaaggctgag
aagaaagttacttctgaaacaaaaaagaaagaaaaagaagatatcaaaaagaaaagtgag
aaggaaactgccattgatgtggaaaaaaaagagccgggaaaagcttctgaaaccaaacaa
gggactgtaaaaattgcagcacaagcagcagctaagaaggatgaaaagaaggaagattcc
aagaaaacaaaaaaacctgcagaagtagaacaacccaagggaaaaaaacaggaaaagaaa
gaaaaacatgtggaaccagcaaagtcaccaaagaaagaacactcagttccaagtgacaaa
caagtaaaagcaaaaactgaacgagccaaagaggagattggtgcggtttcaattaaaaaa
gctgtacctggaaagaaggaagagaaaacaaccaagacagtggagcaagaaattagaaaa
gaaaaatctgggaagacttcttcaattctgaaagataaagaacctattaaagggaaagaa
gagaaagttccagcttccctaaaggaaaaagaacctgaaactaaaaaagatgaaaagatg
tccaaagcaggcaaagaagtcaagcctaaacctccacaactacaaggaaaaaaggaagag
aagccagagccccaaattaaaaaagaagcaaaaccagctatatctgaaaaagtgcaaata
cacaaacaagacatagtgaaaccagaaaagactgtttctcatggtaaaccagaagaaaaa
gttctcaagcaggtaaaagctgtcacaatagaaaaaacagccaagcccaaaccaacaaaa
aaagctgaacatcgagaaagagaacctccatctataaaaacagacaaaccaaaaccaact
ccaaaaggaacatcagaagtcacagaatcaggaaagaagaaaactgaaatatctgaaaaa
gaaagtaaagaaaaagcagacatgaagcatcttagagaagaaaaagtctcaacaagaaaa
gaaagtcttcaattacacaatgtgacaaaagcagaaaaacctgcaagagtatcaaaagat
gttgaagatgtaccagcttcaaagaaagctaaagaaggaactgaagatgtgtctcccaca
aagcagaaaagtcccatcagtttcttccagtgtgtctacttggatgggtacaatggctat
ggatttcagtttcctttcactcctgcagaccgccctggagagagctctggtcaagcaaat
tctccaggacagaagcaacaaggacagtaa

DBGET integrated database retrieval system