KEGG   Homo sapiens (human): 10346Help
Entry
10346             CDS       T01001                                 

Gene name
TRIM22, GPSTAF50, RNF94, STAF50
Definition
(RefSeq) tripartite motif containing 22
  KO
K11999  tripartite motif-containing protein 6/22/34
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10346 (TRIM22)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    10346 (TRIM22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_UBOX zf-C3HC4_4 zf-C3HC4 zf-B_box zf-C3HC4_2 SPRY zf-RING_2 zf-RING_5 zf-C3HC4_3 zf-RING_6 zf-Nse U-box zf-RING_10 Prok-RING_4 zf-RING_4
Motif
Other DBs
NCBI-GeneID: 10346
NCBI-ProteinID: NP_006065
OMIM: 606559
HGNC: 16379
Ensembl: ENSG00000132274
Vega: OTTHUMG00000066904
Pharos: Q8IYM9(Tbio)
UniProt: Q8IYM9 B4DQS5
Position
11p15.4
AA seq 498 aa AA seqDB search
MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVIISRGESSCPVCQ
TRFQPGNLRPNRHLANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCE
LSQEHQGHQTFRINEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIER
QKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRR
LRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRVPDLSGMLQVLKELTDVQYYW
VDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYFSSGKYYWEVD
VSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYWVIGLQNTCEYNA
FEDSSSSDPKVLTLFMAVPPCRIGVFLDYEAGIVSFFNVTNHGALIYKFSGCRFSRPAYP
YFNPWNCLVPMTVCPPSS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggatttctcagtaaaggtagacatagagaaggaggtgacctgccccatctgcctggag
ctcctgacagaacctctgagcctagattgtggccacagcttctgccaagcctgcatcact
gcaaagatcaaggagtcagtgatcatctcaagaggggaaagcagctgtcctgtgtgtcag
accagattccagcctgggaacctccgacctaatcggcatctggccaacatagttgagaga
gtcaaagaggtcaagatgagcccacaggaggggcagaagagagatgtctgtgagcaccat
ggaaaaaaactccagatcttctgtaaggaggatggaaaagtcatttgctgggtttgtgaa
ctgtctcaggaacaccaaggtcaccaaacattccgcataaacgaggtggtcaaggaatgt
caggaaaagctgcaggtagccctgcagaggctgataaaggaggatcaagaggctgagaag
ctggaagatgacatcagacaagagagaaccgcctggaagaattatatccagatcgagaga
cagaagattctgaaagggttcaatgaaatgagagtcatcttggacaatgaggagcagaga
gagctgcaaaagctggaggaaggtgaggtgaatgtgctggataacctggcagcagctaca
gaccagctggtccagcagaggcaggatgccagcacgctcatctcagatctccagcggagg
ttgaggggatcgtcagtagagatgctgcaggatgtgattgacgtcatgaaaaggagtgaa
agctggacattgaagaagccaaaatctgtttccaagaaactaaagagtgtattccgagta
ccagatctgagtgggatgctgcaagttcttaaagagctgacagatgtccagtactactgg
gtggacgtgatgctgaatccaggcagtgccacttcgaatgttgctatttctgtggatcag
agacaagtgaaaactgtacgcacctgcacatttaagaattcaaatccatgtgatttttct
gcttttggtgtcttcggctgccaatatttctcttcggggaaatattactgggaagtagat
gtgtctggaaagattgcctggatcctgggcgtacacagtaaaataagtagtctgaataaa
aggaagagctctgggtttgcttttgatccaagtgtaaattattcaaaagtttactccaga
tatagacctcaatatggctactgggttataggattacagaatacatgtgaatataatgct
tttgaggactcctcctcttctgatcccaaggttttgactctctttatggctgtgcctccc
tgtcgtattggggttttcctagactatgaggcaggcattgtctcatttttcaatgtcaca
aaccacggagcactcatctacaagttctctggatgtcgcttttctcgacctgcttatccg
tatttcaatccttggaactgcctagtccccatgactgtgtgcccaccgagctcctga

DBGET integrated database retrieval system