KEGG   Homo sapiens (human): 10352Help
Entry
10352             CDS       T01001                                 

Gene name
WARS2, NEMMLAS, TrpRS, mtTrpRS
Definition
(RefSeq) tryptophanyl tRNA synthetase 2, mitochondrial
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    10352 (WARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    10352 (WARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    10352 (WARS2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     10352 (WARS2)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   10352 (WARS2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    10352 (WARS2)
 Prokaryotic type
    10352 (WARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1b DUF2067 NCD1
Motif
Other DBs
NCBI-GeneID: 10352
NCBI-ProteinID: NP_056651
OMIM: 604733
HGNC: 12730
Ensembl: ENSG00000116874
Vega: OTTHUMG00000012335
Pharos: Q9UGM6(Tbio)
UniProt: Q9UGM6
Structure
PDB: 

Position
1p12
AA seq 360 aa AA seqDB search
MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWV
RLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEH
TQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGE
DQVQHMELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRI
TDSPEEIVQKFRKAVTDFTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTA
RYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGFL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcactcaatgcggaaagcgcgtgagcgctggagcttcatccgggcacttcat
aagggatccgcagctgctcccgctctccagaaagacagcaagaagcgagtattttccggc
attcaacctacaggaatcctccacctgggcaattacctgggagccattgagagctgggtg
aggttacaggatgaatatgactctgtattatacagcattgttgacctccactccattact
gtcccccaagacccagctgtccttcggcagagcatcctggacatgactgctgttcttctt
gcctgtggcataaacccggaaaaaagcatccttttccaacaatctcaggtgtctgaacac
acacaattaagttggatcctttcctgcatggtcagactacctcgattacaacatttacat
cagtggaaggcaaagactaccaagcagaagcacgatggcacggtgggcctgctcacatac
ccagtactccaggcagccgacattctgttgtacaagtccacacacgttcctgttggggag
gatcaagtccagcacatggaactagttcaggatctagcacaaggtttcaacaagaagtat
ggggagttctttccagtgcccgagtccattctcacatccatgaagaaggtaaaatcccta
cgtgatccttctgccaaaatgtcgaaatcagaccctgacaaactggccaccgtccgaata
acagacagcccagaggagatagtgcagaaattccgcaaggctgtgacagacttcacctcg
gaggtcacctatgacccggctggccgcgctggcgtgtccaacatagtggcggtgcatgcc
gcggtgacggggctctccgtggaggaagtggtgcgccgcagcgcgggcatgaacactgct
cgctacaagctggccgtggcagatgctgtgattgagaagtttgccccaattaagcgtgaa
attgaaaaactgaagctggacaaggaccatttagagaaggttttacaaattggatcagca
aaagccaaagaattagcatacactgtgtgccaggaggtgaagaaattggtgggttttcta
tag

DBGET integrated database retrieval system