KEGG   Homo sapiens (human): 10360
Entry
10360             CDS       T01001                                 
Symbol
NPM3, PORMIN, TMEM123
Name
(RefSeq) nucleophosmin/nucleoplasmin 3
  KO
K11278  nucleophosmin 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10360 (NPM3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Nucleoplasmins
     10360 (NPM3)
SSDB
Motif
Pfam: Nucleoplasmin NPL Nitrophorin
Other DBs
NCBI-GeneID: 10360
NCBI-ProteinID: NP_008924
OMIM: 606456
HGNC: 7931
Ensembl: ENSG00000107833
UniProt: O75607
Position
10:complement(101781325..101783446)
AA seq 178 aa
MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
NT seq 537 nt   +upstreamnt  +downstreamnt
atggccgccggtactgcagctgccttagcgtttttgagtcaggagagccgaacgcgggcc
gggggtgtcgggggcctacgggtcccggccccggtcactatggacagttttttcttcggc
tgtgagctctccggccacacccgctccttcacctttaaggtagaggaagaggatgatgcg
gagcacgtgctggcactaaccatgctctgcctcaccgagggagccaaagacgagtgtaat
gtggtagaagttgtggcccggaaccatgaccatcaggagatcgcagtccctgtggccaac
ctcaagctgtcctgccaacccatgctcagtctggatgacttccagctccaaccacctgta
accttccgcctgaagtcgggctctggccctgtgcggatcactgggcggcaccagattgtt
acgatgagcaatgatgtttctgaggaggagagcgaggaagaggaagaggacagtgatgag
gaagaagttgagctgtgccccatccttcctgccaaaaagcaggggggcaggccctag

DBGET integrated database retrieval system