KEGG   Homo sapiens (human): 10361
Entry
10361             CDS       T01001                                 
Symbol
NPM2
Name
(RefSeq) nucleophosmin/nucleoplasmin 2
  KO
K11277  nucleophosmin 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10361 (NPM2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Nucleoplasmins
     10361 (NPM2)
SSDB
Motif
Pfam: Nucleoplasmin NPL YL1 CENP-B_dimeris PFF1_TM
Other DBs
NCBI-GeneID: 10361
NCBI-ProteinID: NP_001273609
OMIM: 608073
HGNC: 7930
Ensembl: ENSG00000158806
UniProt: Q86SE8
Position
8:22024134..22036897
AA seq 214 aa
MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMH
RVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQER
YEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKK
LEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaatctcagtagcgccagtagcacggaggaaaaggcagtgacgaccgtgctctggggc
tgcgagctcagtcaggagaggcggacttggaccttcagaccccagctggaggggaagcag
agctgcaggctgttgcttcatacgatttgcttgggggagaaagccaaagaggagatgcat
cgcgtggagatcctgcccccagcaaaccaggaggacaagaagatgcagccggtcaccatt
gcctcactccaggcctcagtcctccccatggtctccatggtaggagtgcagctttctccc
ccagttactttccagctccgggctggctcaggacccgtgttcctcagtggccaggaacgt
tatgaagcatcagacctaacctgggaggaggaggaggaagaagaaggggaggaggaggaa
gaggaagaggaagatgatgaggatgaggatgcagatatatctctggaggagcaaagccct
gtcaaacaagtcaaaaggctggtgccccagaagcaggcgagcgtggctaagaaaaaaaag
ctggaaaaagaagaagaggaaataagagccagcgttagagacaagagccctgtgaaaaag
gccaaagccacagccagagccaagaagccaggattcaagaaatga

DBGET integrated database retrieval system